High Mobility Group Box 3 (HMGB3) anticorps

Détails pour le produit réf. ABIN4951316
Antigène
  • HMG-2a
  • HMG-4
  • HMG2A
  • HMG4
  • Hmg2a
  • Hmg4
  • RGD1564407
  • hmgb3
  • MGC54022
  • Xhmgb3
  • MGC88931
  • fa19b06
  • fj43d02
  • wu:fa19b06
  • wu:fj43d02
  • zgc:112073
  • HMGB3
  • NFD03
  • NFD3
  • NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR
  • high mobility group B3
  • HMG-1
  • HMG2a
  • HMGB1
  • high mobility group box 3
  • high mobility group box 3b
  • high mobility group box 3 S homeolog
  • high mobility group protein
  • high mobility group B3
  • High mobility group protein B3
  • HMGB3
  • Hmgb3
  • hmgb3
  • hmgb3b
  • hmgb3.S
Reactivité
Humain, Souris, Rat (Rattus)
74
31
12
8
7
7
4
4
3
3
2
1
1
1
1
1
1
1
Hôte
Lapin
64
7
5
1
Clonalité
Polyclonal
Conjugué
Inconjugué
5
4
4
3
3
3
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
67
35
17
8
2
1
1
1
Options
Immunogène Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR of human HMG4 were used as the immunogen for the HMG4 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation HMGB3 / HMG4 (HMGB3 Antibody Extrait)
Sujet High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
UniProt O15347
Indications d'application Optimal dilution of the HMG4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the HMG4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-High Mobility Group Box 3 (HMGB3) antibody (ABIN4951316) IHC testing of FFPE rat intestine with HMG4 antibody. HIER: Boil the paraffin section...
Image no. 2 for anti-High Mobility Group Box 3 (HMGB3) antibody (ABIN4951316) Western blot testing of 1) mouse liver, 2) mouse kidney, 3) mouse testis, 4) human 22...
Image no. 3 for anti-High Mobility Group Box 3 (HMGB3) antibody (ABIN4951316) IHC testing of FFPE mouse intestine with HMG4 antibody. HIER: Boil the paraffin secti...
Avez-vous cherché autre chose?