HMGB3 anticorps

N° du produit ABIN4951316

Détail du produit anti-HMGB3 anticorps

Antigène: HMGB3 (High Mobility Group Box 3 (HMGB3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HMGB3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR of human HMG4 were used as the immunogen for the HMG4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HMG4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the HMG4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HMGB3

Antigène: HMGB3 (High Mobility Group Box 3 (HMGB3))

Autre désignation: HMGB3 / HMG4 (HMGB3 Produits)

Synonymes: anticorps HMG-2a, anticorps HMG-4, anticorps HMG2A, anticorps HMG4, anticorps Hmg2a, anticorps Hmg4, anticorps RGD1564407, anticorps hmgb3, anticorps MGC54022, anticorps Xhmgb3, anticorps MGC88931, anticorps fa19b06, anticorps fj43d02, anticorps wu:fa19b06, anticorps wu:fj43d02, anticorps zgc:112073, anticorps HMGB3, anticorps NFD03, anticorps NFD3, anticorps NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR, anticorps high mobility group B3, anticorps HMG-1, anticorps HMG2a, anticorps HMGB1, anticorps high mobility group box 3, anticorps high mobility group box 3b, anticorps high mobility group box 3 S homeolog, anticorps high mobility group protein, anticorps high mobility group B3, anticorps High mobility group protein B3, anticorps HMGB3, anticorps Hmgb3, anticorps hmgb3, anticorps hmgb3b, anticorps hmgb3.S

Sujet: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

UniProt: O15347