HNF1 Homeobox B (HNF1B) anticorps

Détails pour le produit réf. ABIN4951323
Antigène
  • TCF2
  • HNF1B
  • FJHN
  • HNF-1B
  • HNF1beta
  • HNF2
  • HPC11
  • LF-B3
  • LFB3
  • MODY5
  • TCF-2
  • VHNF1
  • hnf-1beta
  • hnf1-beta
  • hnf1beta
  • lfb3
  • tcf2
  • vhnf1
  • vHNF-1
  • AI385728
  • AI987804
  • HNF-1Beta
  • Hnf1beta
  • Tcf-2
  • Tcf2
  • vHNF1
  • HNF-1b
  • chunp6877
  • hnf1b
  • mst
  • HNF1 homeobox B
  • HNF1 homeobox B L homeolog
  • HNF1 homeobox Ba
  • HNF1 homeobox B S homeolog
  • HNF1B
  • hnf1b.L
  • Hnf1b
  • hnf1ba
  • hnf1b.S
Reactivité
Humain, Rat (Rattus)
117
59
55
10
8
8
8
7
7
4
4
3
3
Hôte
Lapin
96
21
7
Clonalité
Polyclonal
Conjugué
Inconjugué
6
3
3
3
3
3
3
3
3
3
3
3
Application
Western Blotting (WB)
105
60
17
9
7
5
5
4
3
3
1
Options
Immunogène Amino acids AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT of human HNF1 beta were used as the immunogen for the HNF1 beta antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation HNF1B (HNF1B Antibody Extrait)
Sujet HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B), also known as HNF1B or transcription factor 2 (TCF2), is a human gene. It is a member of the homeodomain-containing superfamily of transcription factors. This gene is mapped to 17q12. The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1. HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis. HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3. Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5).
UniProt P35680
Pathways Hormone Transport, Stem Cell Maintenance, Tube Formation
Indications d'application Optimal dilution of the HNF1 beta antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the HNF1 beta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-HNF1 Homeobox B (HNF1B) antibody (ABIN4951323) Western blot testing of 1) rat liver, 2) rat kidney, 3) human SW620 lysate with HNF1 ...
Avez-vous cherché autre chose?