HNF1B anticorps
-
- Antigène Voir toutes HNF1B Anticorps
- HNF1B (HNF1 Homeobox B (HNF1B))
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HNF1B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogène
- Amino acids AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT of human HNF1 beta were used as the immunogen for the HNF1 beta antibody.
- Isotype
- IgG
- Top Product
- Discover our top product HNF1B Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the HNF1 beta antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the HNF1 beta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- HNF1B (HNF1 Homeobox B (HNF1B))
- Autre désignation
- HNF1B (HNF1B Produits)
- Synonymes
- anticorps FJHN, anticorps HNF-1B, anticorps HNF1beta, anticorps HNF2, anticorps HPC11, anticorps LF-B3, anticorps LFB3, anticorps MODY5, anticorps TCF-2, anticorps TCF2, anticorps VHNF1, anticorps HNF-1b, anticorps HNF1B, anticorps AI385728, anticorps AI987804, anticorps HNF-1Beta, anticorps Hnf1beta, anticorps Tcf-2, anticorps Tcf2, anticorps vHNF1, anticorps vHNF-1, anticorps chunp6877, anticorps hnf1b, anticorps mst, anticorps tcf2, anticorps vhnf1, anticorps lfb3, anticorps hnf-1beta, anticorps hnf1-beta, anticorps hnf1beta, anticorps HNF1g, anticorps wu:fc23f06, anticorps HNF1 homeobox B, anticorps HNF1 homeobox Ba, anticorps HNF1 homeobox B S homeolog, anticorps HNF1 homeobox B L homeolog, anticorps HNF1 homeobox Bb, anticorps HNF1B, anticorps Hnf1b, anticorps hnf1ba, anticorps hnf1b.S, anticorps hnf1b.L, anticorps hnf1bb
- Sujet
- HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B), also known as HNF1B or transcription factor 2 (TCF2), is a human gene. It is a member of the homeodomain-containing superfamily of transcription factors. This gene is mapped to 17q12. The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1. HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis. HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3. Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5).
- UniProt
- P35680
- Pathways
- Hormone Transport, Stem Cell Maintenance, Tube Formation
-