HRAS anticorps (V-Ha-Ras Harvey Rat Sarcoma Viral Oncogene Homolog)

Details for Product anti-HRAS Antibody No. ABIN4951352
  • C-H-RAS
  • C-HA-RAS1
  • CTLO
  • HRAS1
  • K-RAS
  • N-RAS
  • RASH1
  • hras
  • zgc:110250
  • HRAS
  • H-RAS
  • c-H-ras
  • H-Ras
  • K-Ras
  • hras1
  • rash1
  • ras
  • N-Ras
  • c-bas/has
  • H-ras
  • Ha-ras
  • Harvey-ras
  • Hras-1
  • Kras2
  • c-Ha-ras
  • c-rasHa
  • HRas proto-oncogene, GTPase
  • v-Ha-ras Harvey rat sarcoma viral oncogene homolog a
  • neuroblastoma RAS viral (v-ras) oncogene homolog pseudogene
  • Harvey rat sarcoma viral oncogene homolog L homeolog
  • Harvey rat sarcoma viral oncogene homolog
  • Harvey rat sarcoma virus oncogene
  • HRAS
  • hrasa
  • LOC733587
  • Hras
  • hras.L
  • hras
Humain, Souris, Rat (Rattus)
Cet anticorp HRAS est non-conjugé
Western Blotting (WB)
Immunogène Amino acids KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSY of human HRAS were used as the immunogen for the HRAS antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others HRAS products on genomics-online (e.g. as negative or positive controls)
Autre désignation HRAS (HRAS Antibody Extrait)
Sujet GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.
UniProt P01112
Pathways Signalisation p53, Signalisation MAPK, Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hepatitis C, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Regulation of long-term Neuronal Synaptic Plasticity, VEGF Signaling
Indications d'application Optimal dilution of the HRAS antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the HRAS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-V-Ha-Ras Harvey Rat Sarcoma Viral Oncogene Homolog (HRAS) antibody (ABIN4951352) Western blot testing of 1) rat brain, 2) mouse brain, and 3) mouse HEPA lysate with H...
Avez-vous cherché autre chose?