Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2) anticorps

Détails pour le produit réf. ABIN4951362
Antigène
  • MGC81883
  • 11-HSD2
  • AME
  • AME1
  • HSD11K
  • HSD2
  • SDR9C3
  • 11HSD2
  • HSD11B2
  • hydroxysteroid (11-beta) dehydrogenase 2 L homeolog
  • hydroxysteroid 11-beta dehydrogenase 2
  • hsd11b2.L
  • HSD11B2
  • Hsd11b2
Reactivité
Humain, Souris, Rat (Rattus)
100
56
48
2
2
2
2
1
1
1
1
1
1
Hôte
Lapin
102
8
1
1
Clonalité
Polyclonal
Conjugué
Inconjugué
6
5
5
3
3
3
3
3
3
2
2
2
2
2
2
2
2
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
78
42
35
26
18
17
7
6
4
3
Options
Immunogène Amino acids EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH of human HSD11B2 were used as the immunogen for the HSD11B2 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation HSD11B2 (HSD11B2 Antibody Extrait)
Sujet Corticosteroid 11-β,-dehydrogenase isozyme 2, also known as 11-β,-hydroxysteroid dehydrogenase 2, is an enzyme that in humans is encoded by the HSD11B2 gene. There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension.
UniProt P80365
Pathways Steroid Hormone Biosynthesis, Regulation of Systemic Arterial Blood Pressure by Hormones
Indications d'application Optimal dilution of the HSD11B2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the HSD11B2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2) antibody (ABIN4951362) IHC testing of rat pancreas with HSD11B2 antibody. HIER: Boil the paraffin sections i...
Image no. 2 for anti-Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2) antibody (ABIN4951362) Western blot testing of 1) rat kidney and 2) human placenta lysate with HSD11B2 antib...
Image no. 3 for anti-Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2) antibody (ABIN4951362) IHC testing of mouse pancreas with HSD11B2 antibody. HIER: Boil the paraffin sections...
Avez-vous cherché autre chose?