Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1) anticorps

Détails pour le produit réf. ABIN4951373
Antigène
  • D6S182
  • HSP84
  • HSP90B
  • HSPC2
  • HSPCB
  • GRP94
  • TRA1
  • hsp90b
  • 90kDa
  • AL022974
  • C81438
  • Hsp84
  • Hsp84-1
  • Hsp90
  • Hspcb
  • HSP90-BETA
  • hsp90beta
  • wu:fa29f01
  • wu:fa91e11
  • wu:fd59e11
  • wu:gcd22h07
  • HSP90
  • heat shock protein 90 alpha family class B member 1
  • heat shock protein 90 beta family member 1
  • Heat Shock Protein 90, endoplasmic reticulum
  • heat shock protein 90B
  • heat shock protein 90 alpha (cytosolic), class B member 1
  • heat shock protein 90kDa alpha family class B member 1 S homeolog
  • heat shock protein 90, alpha (cytosolic), class B member 1
  • HSP90AB1
  • HSP90B1
  • HSP90B
  • hsp90ab1
  • Hsp90ab1
  • hsp90ab1.S
Reactivité
Humain, Souris, Rat (Rattus)
338
251
212
39
22
18
15
10
9
8
8
7
5
3
2
1
1
1
1
1
1
1
Hôte
Lapin
245
92
1
Clonalité
Polyclonal
Conjugué
Inconjugué
14
8
8
8
8
8
8
6
5
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
278
158
144
92
65
50
44
42
15
14
6
5
3
3
1
1
Options
Immunogène Amino acids RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK of human HSP90AB1 were used as the immunogen for the Hsp90 beta antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation HSP90 beta / HSP90AB1 (HSP90AB1 Antibody Extrait)
Sujet Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family, these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.
UniProt P08238
Pathways Regulation of Cell Size
Indications d'application Optimal dilution of the HSP90 beta antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the HSP90 beta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1) antibody (ABIN4951373) Western blot testing of 1) rat testis, 2) rat thymus, 3) human placenta, 4) SW620 and...
Image no. 2 for anti-Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1) antibody (ABIN4951373) IHC testing of FFPE mouse testis with HSP90 beta antibody. HIER: Boil the paraffin se...
Image no. 3 for anti-Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1) antibody (ABIN4951373) IHC testing of FFPE rat testis with HSP90 beta antibody. HIER: Boil the paraffin sect...
Avez-vous cherché autre chose?