HSP90AB1 anticorps

N° du produit ABIN4951373

Détail du produit anti-HSP90AB1 anticorps

Antigène: HSP90AB1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSP90AB1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK of human HSP90AB1 were used as the immunogen for the Hsp90 beta antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HSP90 beta antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the HSP90 beta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HSP90AB1

Antigène: HSP90AB1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1))

Autre désignation: HSP90 beta / HSP90AB1 (HSP90AB1 Produits)

Synonymes: anticorps D6S182, anticorps HSP84, anticorps HSP90B, anticorps HSPC2, anticorps HSPCB, anticorps GRP94, anticorps TRA1, anticorps hsp90b, anticorps 90kDa, anticorps AL022974, anticorps C81438, anticorps Hsp84, anticorps Hsp84-1, anticorps Hsp90, anticorps Hspcb, anticorps Hsp70, anticorps Hsp70-1, anticorps Hsp70.1, anticorps hsp68, anticorps HSP90-BETA, anticorps hsp90beta, anticorps wu:fa29f01, anticorps wu:fa91e11, anticorps wu:fd59e11, anticorps wu:gcd22h07, anticorps HSP90, anticorps heat shock protein 90 alpha family class B member 1, anticorps heat shock protein 90 beta family member 1, anticorps Heat Shock Protein 90, endoplasmic reticulum, anticorps heat shock protein 90B, anticorps heat shock protein 90 alpha (cytosolic), class B member 1, anticorps heat shock protein 1B, anticorps heat shock protein 90kDa alpha family class B member 1 S homeolog, anticorps heat shock protein 90, alpha (cytosolic), class B member 1, anticorps HSP90AB1, anticorps HSP90B1, anticorps HSP90B, anticorps hsp90ab1, anticorps Hsp90ab1, anticorps Hspa1b, anticorps hsp90ab1.S

Sujet: Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family, these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.

UniProt: P08238

Pathways: Regulation of Cell Size