Indoleamine 2,3-Dioxygenase (IDO) anticorps

Détails pour le produit réf. ABIN4951410
Antigène
Reactivité
Humain, Souris, Rat (Rattus)
28
8
5
1
1
Hôte
Lapin
19
15
6
Clonalité
Polyclonal
Conjugué
Inconjugué
5
3
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
35
22
10
9
8
7
7
6
4
3
1
1
Options
Immunogène Amino acids NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH of human IDO1 were used as the immunogen for the IDO1 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation IDO1 / Indoleamine 2, 3-dioxygenase
Sujet IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO or IDO, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells. This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine. By fluorescence in situ hybridization, the assignment is narrowed to chromosome 8p12-p11. INDO Interferon-gamma has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase. During inflammation, IDO is upregulated in dendritic cells and phagocytes by proinflammatory stimuli, most notably IFNG, and the enzyme then uses superoxide as a 'cofactor' for oxidative cleavage of the indole ring of tryptophan, yielding an intermediate that deformylates to L-kynurenine.
UniProt P14902
Indications d'application Optimal dilution of the IDO1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the IDO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Indoleamine 2,3-Dioxygenase (IDO) antibody (ABIN4951410) Western blot testing of 1) rat lung, 2) rat spleen, 3) human placenta, 4) A549, 5) SW...
Avez-vous cherché autre chose?