Insulin-Like Growth Factor Binding Protein 1 (IGFBPI) anticorps

Détails pour le produit réf. ABIN4951423
Antigène
  • cb656
  • igfbp1
  • IGFBP-1
  • MGC68538
  • afbp
  • ibp1
  • pp12
  • igf-bp25
  • higfbp-1
  • IGFBP1
  • LOC100223208
  • LOC100305121
  • AFBP
  • IBP1
  • IGF-BP25
  • PP12
  • hIGFBP-1
  • IGFBA
  • insulin like growth factor binding protein 1
  • insulin-like growth factor binding protein 1a
  • insulin like growth factor binding protein 1 S homeolog
  • insulin like growth factor binding protein 1 L homeolog
  • insulin-like growth factor binding protein 1
  • IGFBP1
  • igfbp1a
  • igfbp1.S
  • igfbp1.L
  • igfbp1
  • LOC100305121
  • Igfbp1
Reactivité
Souris, Rat (Rattus)
139
44
28
5
5
2
2
2
2
2
Hôte
Lapin
127
37
10
3
Clonalité
Polyclonal
Conjugué
Inconjugué
16
9
6
2
2
2
2
2
2
2
2
2
1
Application
ELISA, Western Blotting (WB)
153
98
51
20
16
15
14
10
2
2
2
2
1
1
1
1
Options
Immunogène Amino acids REIADLKKWKEPCQRELYKVLERLAAAQQKA of mouse IGFBP1 were used as the immunogen for the IGFBP1antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation IGFBP1 (IGFBPI Antibody Extrait)
Sujet IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
UniProt P47876
Pathways Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Growth Factor Binding
Indications d'application Optimal dilution of the IGFBP1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the IGFBP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Insulin-Like Growth Factor Binding Protein 1 (IGFBPI) antibody (ABIN4951423) Western blot testing of 1) rat kidney and 2) mouse kidney lysate with IGFBP1 antibody...
Avez-vous cherché autre chose?