IGFBPI anticorps

N° du produit ABIN4951423

Détail du produit anti-IGFBPI anticorps

Antigène: IGFBPI (Insulin-Like Growth Factor Binding Protein 1 (IGFBPI))

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGFBPI est non-conjugé

Application: Western Blotting (WB), ELISA

Purification: Antigen affinity

Immunogène: Amino acids REIADLKKWKEPCQRELYKVLERLAAAQQKA of mouse IGFBP1 were used as the immunogen for the IGFBP1antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the IGFBP1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the IGFBP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur IGFBPI

Antigène: IGFBPI (Insulin-Like Growth Factor Binding Protein 1 (IGFBPI))

Autre désignation: IGFBP1 (IGFBPI Produits)

Synonymes: anticorps cb656, anticorps igfbp1, anticorps IGFBP-1, anticorps MGC68538, anticorps afbp, anticorps ibp1, anticorps pp12, anticorps igf-bp25, anticorps higfbp-1, anticorps IGFBP1, anticorps LOC100223208, anticorps LOC100305121, anticorps AFBP, anticorps IBP1, anticorps IGF-BP25, anticorps PP12, anticorps hIGFBP-1, anticorps IGFBA, anticorps insulin like growth factor binding protein 1, anticorps insulin-like growth factor binding protein 1a, anticorps insulin like growth factor binding protein 1 S homeolog, anticorps insulin like growth factor binding protein 1 L homeolog, anticorps insulin-like growth factor binding protein 1, anticorps IGFBP1, anticorps igfbp1a, anticorps igfbp1.S, anticorps igfbp1.L, anticorps igfbp1, anticorps LOC100305121, anticorps Igfbp1

Sujet: IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

UniProt: P47876

Pathways: Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Growth Factor Binding