ING1 anticorps

N° du produit ABIN4951466

Détail du produit anti-ING1 anticorps

Antigène: ING1 (Inhibitor of Growth Family, Member 1 (ING1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ING1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids KELDECYERFSRETDGAQKRRMLHCVQRALIR of human Inhibitor of growth protein 1 were used as the immunogen for the ING1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ING1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ING1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ING1

Antigène: ING1 (Inhibitor of Growth Family, Member 1 (ING1))

Autre désignation: ING1 (ING1 Produits)

Synonymes: anticorps p24ING1c, anticorps p33, anticorps p33ING1, anticorps p33ING1b, anticorps p47, anticorps p47ING1a, anticorps p33ING1c, anticorps zgc:136918, anticorps ING1, anticorps 2610028J21Rik, anticorps AA407184, anticorps AI875420, anticorps mING1h, anticorps p33Ing1, anticorps p37Ing1b, anticorps xing1, anticorps inhibitor of growth family member 1, anticorps inhibitor of growth family, member 1, anticorps inhibitor of growth family member 1 S homeolog, anticorps ING1, anticorps Ing1, anticorps ing1, anticorps ing1.S

Sujet: Inhibitor of growth protein 1 is a protein that in humans is encoded by the ING1 gene. It is mapped to 13q34. This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

UniProt: Q9UK53

Pathways: Protein targeting to Nucleus, Autophagy