Inhibitor of Growth Family, Member 1 (ING1) anticorps

Détails pour le produit réf. ABIN4951466
Antigène
  • p24ING1c
  • p33
  • p33ING1
  • p33ING1b
  • p47
  • p47ING1a
  • p33ING1c
  • zgc:136918
  • ING1
  • 2610028J21Rik
  • AA407184
  • AI875420
  • mING1h
  • p33Ing1
  • p37Ing1b
  • xing1
  • inhibitor of growth family member 1
  • inhibitor of growth family, member 1
  • inhibitor of growth family member 1 S homeolog
  • ING1
  • Ing1
  • ing1
  • ing1.S
Reactivité
Humain
147
81
31
2
2
2
2
2
1
1
1
1
Hôte
Lapin
120
27
7
Clonalité
Polyclonal
Conjugué
Inconjugué
8
7
6
4
4
3
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
125
95
42
31
13
12
7
5
5
4
4
1
Options
Immunogène Amino acids KELDECYERFSRETDGAQKRRMLHCVQRALIR of human Inhibitor of growth protein 1 were used as the immunogen for the ING1 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation ING1 (ING1 Antibody Extrait)
Sujet Inhibitor of growth protein 1 is a protein that in humans is encoded by the ING1 gene. It is mapped to 13q34. This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
UniProt Q9UK53
Pathways Protein targeting to Nucleus, Autophagy
Indications d'application Optimal dilution of the ING1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the ING1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Inhibitor of Growth Family, Member 1 (ING1) antibody (ABIN4951466) Western blot testing of human 1) HeLa and 2) A549 cell lysate with ING1 antibody. Exp...
Avez-vous cherché autre chose?