Involucrin (IVL) anticorps

Détails pour le produit réf. ABIN4951472
Antigène
  • 1110019C06Rik
  • IVL
  • involucrin
  • IVL
  • Ivl
Reactivité
Humain
208
60
56
47
34
29
24
21
20
2
Hôte
Lapin
114
110
Clonalité
Polyclonal
Conjugué
Inconjugué
14
6
4
4
4
4
4
4
4
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
100
81
76
70
58
50
46
42
30
18
15
13
10
8
3
1
Options
Immunogène Amino acids QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK of human Involucrin were used as the immunogen for the Involucrin antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation Involucrin (IVL Antibody Extrait)
Sujet Involucrin is a protein component of human skin and in humans is encoded by the IVL gene. It is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermisand other stratified squamous epithelia. It first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath the plasma membrane functioning as a glutamyl donor during assembly of the cornified envelope. Additionally, Involucrin is synthesised in the stratum spinosum and cross linked in the stratum granulosum by the transglutaminase enzyme that makes it highly stable. Thus it provides structural support to the cell, thereby allowing the cell to resist invasion by micro-organisms.
UniProt P07476
Indications d'application Optimal dilution of the Involucrin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the Involucrin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Involucrin (IVL) antibody (ABIN4951472) Western blot testing of human 1) A431 and 2) A549 lysate with Involucrin antibody. Ex...
Avez-vous cherché autre chose?