Involucrin anticorps

N° du produit ABIN4951472

Détail du produit anti-Involucrin anticorps

Antigène: Involucrin (IVL)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Involucrin est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK of human Involucrin were used as the immunogen for the Involucrin antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Involucrin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Involucrin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Involucrin

Antigène: Involucrin (IVL)

Autre désignation: Involucrin (IVL Produits)

Synonymes: anticorps INV, anticorps NPH2, anticorps NPHP2, anticorps 1110019C06Rik, anticorps IVL, anticorps Nphp2, anticorps inv, anticorps involucrin, anticorps inversin, anticorps IVL, anticorps INVS, anticorps Ivl, anticorps Invs

Sujet: Involucrin is a protein component of human skin and in humans is encoded by the IVL gene. It is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermisand other stratified squamous epithelia. It first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath the plasma membrane functioning as a glutamyl donor during assembly of the cornified envelope. Additionally, Involucrin is synthesised in the stratum spinosum and cross linked in the stratum granulosum by the transglutaminase enzyme that makes it highly stable. Thus it provides structural support to the cell, thereby allowing the cell to resist invasion by micro-organisms.

UniProt: P07476