IRF2 anticorps

N° du produit ABIN4951480

Détail du produit anti-IRF2 anticorps

Antigène: IRF2 (Interferon Regulatory Factor 2 (IRF2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IRF2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids MTPASSSSRPDRETRASVIKKTSDITQARVKS of human IRF2 were used as the immunogen for the IRF2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the IRF2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the IRF2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur IRF2

Antigène: IRF2 (Interferon Regulatory Factor 2 (IRF2))

Autre désignation: IRF2 (IRF2 Produits)

Synonymes: anticorps IRF-2, anticorps 9830146E22Rik, anticorps AI646973, anticorps Irf-2, anticorps irf2b, anticorps zgc:103451, anticorps irf-2, anticorps wu:fc74h04, anticorps zgc:76951, anticorps interferon regulatory factor 2, anticorps interferon regulatory factor 2 L homeolog, anticorps interferon regulatory factor 2a, anticorps IRF2, anticorps Irf2, anticorps irf2, anticorps irf2.L, anticorps irf2a

Sujet: Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation. [UniProt]

UniProt: P14316