Interferon Regulatory Factor 2 (IRF2) anticorps

Détails pour le produit réf. ABIN4951480
Antigène
  • IRF-2
  • 9830146E22Rik
  • AI646973
  • Irf-2
  • irf2b
  • zgc:103451
  • irf-2
  • interferon regulatory factor 2
  • interferon regulatory factor 2 L homeolog
  • IRF2
  • Irf2
  • irf2
  • irf2.L
Reactivité
Humain, Rat (Rattus)
133
81
57
9
9
7
6
6
6
4
3
2
2
1
Hôte
Lapin
114
12
9
1
Clonalité
Polyclonal
Conjugué
Inconjugué
7
5
4
4
4
3
3
3
3
3
3
3
1
1
1
1
1
1
Application
Western Blotting (WB)
99
51
37
15
13
10
8
6
6
3
3
3
2
1
1
1
Options
Immunogène Amino acids MTPASSSSRPDRETRASVIKKTSDITQARVKS of human IRF2 were used as the immunogen for the IRF2 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation IRF2 (IRF2 Antibody Extrait)
Sujet Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation. [UniProt]
UniProt P14316
Indications d'application Optimal dilution of the IRF2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the IRF2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Interferon Regulatory Factor 2 (IRF2) antibody (ABIN4951480) Western blot testing of 1) rat intestine and human 2) SW620, 3) COLO320, 4) HeLa and ...
Avez-vous cherché autre chose?