HAVCR1 anticorps

N° du produit ABIN4951544

Détail du produit anti-HAVCR1 anticorps

Antigène: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAVCR1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the KIM1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the KIM1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HAVCR1

Antigène: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Autre désignation: KIM-1 / TIM-1 / HAVCR1 (HAVCR1 Produits)

Synonymes: anticorps HAVCR, anticorps HAVCR-1, anticorps KIM-1, anticorps KIM1, anticorps TIM, anticorps TIM-1, anticorps TIM1, anticorps TIMD-1, anticorps TIMD1, anticorps Kim1, anticorps HAVCR1, anticorps LOC100226241, anticorps AI503787, anticorps Tim1, anticorps Timd1, anticorps hepatitis A virus cellular receptor 1, anticorps hepatitis A virus cellular receptor 1 homolog, anticorps HAVCR1, anticorps Havcr1, anticorps LOC100226241

Classe de substances: Virus

Sujet: Kidney injury molecule 1, also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the HAVCR1 gene. It may play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair. [UniProt]

UniProt: Q96D42