HAVCR1 anticorps (Hepatitis A Virus Cellular Receptor 1)

Details for Product anti-HAVCR1 Antibody No. ABIN4951544
Antigène
  • HAVCR
  • HAVCR-1
  • KIM-1
  • KIM1
  • TIM
  • TIM-1
  • TIM1
  • TIMD-1
  • TIMD1
  • Kim1
  • HAVCR1
  • LOC100226241
  • AI503787
  • Tim1
  • Timd1
  • hepatitis A virus cellular receptor 1
  • hepatitis A virus cellular receptor 1 homolog
  • HAVCR1
  • Havcr1
  • LOC100226241
Reactivité
Humain
117
51
28
8
6
2
1
1
Hôte
Lapin
147
35
4
2
Clonalité
Polyclonal
Conjugué
Cet anticorp HAVCR1 est non-conjugé
18
17
7
6
5
3
3
3
3
3
3
2
1
Application
Western Blotting (WB)
122
83
41
21
20
16
13
11
8
7
6
2
1
1
Options
Immunogène Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others HAVCR1 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation KIM-1 / TIM-1 / HAVCR1 (HAVCR1 Antibody Extrait)
Sujet Kidney injury molecule 1, also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the HAVCR1 gene. It may play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair. [UniProt]
UniProt Q96D42
Indications d'application Optimal dilution of the KIM1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the KIM1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Hepatitis A Virus Cellular Receptor 1 (HAVCR1) antibody (ABIN4951544) Western blot testing of human 1) HeLa, 2) PANC, 3) HepG2 and 4) A549 cell lysate with...
Avez-vous cherché autre chose?