X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6) anticorps

Détails pour le produit réf. ABIN4951571
Antigène
  • CTC75
  • CTCBF
  • G22P1
  • KU70
  • ML8
  • TLAA
  • 70kDa
  • G22p1
  • Ku70
  • Kup70
  • X-ray repair cross complementing 6
  • ATP-dependent DNA helicase II, 70 kDa subunit
  • X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog
  • X-ray repair complementing defective repair in Chinese hamster cells 6
  • XRCC6
  • Bm1_41430
  • xrcc6.L
  • Xrcc6
Reactivité
Humain
366
143
98
27
5
4
2
2
2
1
1
1
1
1
Hôte
Lapin
310
56
7
1
Clonalité
Polyclonal
Conjugué
Inconjugué
18
10
10
10
9
9
9
9
9
9
7
7
2
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
302
175
164
89
82
77
36
31
15
13
4
3
3
2
2
1
1
1
Options
Immunogène Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD of human Ku70 were used as the immunogen for the Ku70 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation Ku70 / XRCC6 (XRCC6 Antibody Extrait)
Sujet XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.
UniProt P12956
Pathways Réparation de l'ADN
Indications d'application Optimal dilution of the Ku70 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the Ku70 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6) antibody (ABIN4951571) Western blot testing of human 1) A549, 2) HeLa, 3) HePG2 and 4) MCF7 lysate with Ku70...
Avez-vous cherché autre chose?