XRCC6 anticorps

N° du produit ABIN4951571

Détail du produit anti-XRCC6 anticorps

Antigène: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XRCC6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD of human Ku70 were used as the immunogen for the Ku70 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Ku70 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Ku70 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur XRCC6

Antigène: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Autre désignation: Ku70 / XRCC6 (XRCC6 Produits)

Synonymes: anticorps CTC75, anticorps CTCBF, anticorps G22P1, anticorps KU70, anticorps ML8, anticorps TLAA, anticorps 70kDa, anticorps G22p1, anticorps Ku70, anticorps Kup70, anticorps X-ray repair cross complementing 6, anticorps ATP-dependent DNA helicase II, 70 kDa subunit, anticorps X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog, anticorps X-ray repair complementing defective repair in Chinese hamster cells 6, anticorps XRCC6, anticorps Bm1_41430, anticorps xrcc6.L, anticorps Xrcc6

Sujet: XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.

UniProt: P12956

Pathways: Réparation de l'ADN