KCNA2 anticorps

N° du produit ABIN4951574

Détail du produit anti-KCNA2 anticorps

Antigène: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNA2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids NNSNEDFREENLKTANCTLANTNYVNITKMLTDV of human Kv1.2 were used as the immunogen for the Kv1.2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Kv1.2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Kv1.2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur KCNA2

Antigène: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Autre désignation: Kv1.2 (KCNA2 Produits)

Synonymes: anticorps KCNA2, anticorps kcna2, anticorps HBK5, anticorps HK4, anticorps HUKIV, anticorps KV1.2, anticorps MK2, anticorps NGK1, anticorps RBK2, anticorps Akr6a4, anticorps ENSMUSG00000074335, anticorps Gm10672, anticorps Kca1-2, anticorps Kv1.2, anticorps Mk-2, anticorps BK2, anticorps XSha2, anticorps k(v)1.2, anticorps kcna2-a, anticorps kv1.2, anticorps potassium voltage-gated channel subfamily A member 2, anticorps potassium channel, voltage gated shaker related subfamily A, member 1, anticorps potassium voltage-gated channel, shaker-related subfamily, member 2, anticorps potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog, anticorps KCNA2, anticorps kcna1, anticorps Kcna2, anticorps LOC100537815, anticorps kcna2.S

Sujet: Potassium voltage-gated channel subfamily A member 2, also known as Kv1.2, is a protein that in humans is encoded by the KCNA2 gene. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1.

UniProt: P16389