Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2) anticorps

Détails pour le produit réf. ABIN4951574
Antigène
  • KCNA2
  • kcna2
  • HBK5
  • HK4
  • HUKIV
  • KV1.2
  • MK2
  • NGK1
  • RBK2
  • Akr6a4
  • ENSMUSG00000074335
  • Gm10672
  • Kca1-2
  • Kv1.2
  • Mk-2
  • BK2
  • XSha2
  • k(v)1.2
  • kcna2-a
  • kv1.2
  • potassium voltage-gated channel subfamily A member 2
  • potassium channel, voltage gated shaker related subfamily A, member 1
  • potassium voltage-gated channel, shaker-related subfamily, member 2
  • potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog
  • KCNA2
  • kcna1
  • Kcna2
  • LOC100537815
  • kcna2.S
Reactivité
Humain, Souris, Rat (Rattus)
52
28
17
3
2
2
2
2
2
1
Hôte
Lapin
52
12
Clonalité
Polyclonal
Conjugué
Inconjugué
3
3
3
2
2
2
1
1
1
1
1
1
1
Application
Western Blotting (WB)
59
26
23
9
9
3
2
1
1
1
1
1
1
1
Options
Immunogène Amino acids NNSNEDFREENLKTANCTLANTNYVNITKMLTDV of human Kv1.2 were used as the immunogen for the Kv1.2 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation Kv1.2 (KCNA2 Antibody Extrait)
Sujet Potassium voltage-gated channel subfamily A member 2, also known as Kv1.2, is a protein that in humans is encoded by the KCNA2 gene. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1.
UniProt P16389
Indications d'application Optimal dilution of the Kv1.2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the Kv1.2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2) antibody (ABIN4951574) Western blot testing of 1) rat kidney, 2) rat brain, 3) mouse brain, 4) mouse kidney ...
Avez-vous cherché autre chose?