LCK anticorps (Lymphocyte-Specific Protein tyrosine Kinase)

Details for Product anti-LCK Antibody No. ABIN4951597
Antigène
  • zgc:136695
  • LCK
  • Hck-3
  • Lsk
  • Lskt
  • p56
  • p56Lck
  • LSK
  • YT16
  • p56lck
  • pp58lck
  • P56LCK
  • tkl
  • Lck1
  • Lcktkr
  • LCK proto-oncogene, Src family tyrosine kinase
  • lymphocyte protein tyrosine kinase
  • lck
  • LCK
  • Lck
Reactivité
Humain, Souris, Rat (Rattus)
401
236
181
11
10
8
8
4
4
4
3
2
1
Hôte
Lapin
331
67
9
Clonalité
Polyclonal
Conjugué
Cet anticorp LCK est non-conjugé
14
10
9
6
6
6
6
6
6
6
6
5
2
2
2
2
2
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
345
174
88
57
50
35
34
26
22
12
4
4
3
2
1
1
Options
Immunogène Amino acids ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ of human Lymphocyte-specific protein tyrosine kinase were used as the immunogen for the LCK antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others LCK products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation LCK (LCK Antibody Extrait)
Sujet Lck (or lymphocyte-specific protein tyrosine kinase) is a protein found inside specialized cells of the immune system called lymphocytes. The human LCK gene is mapped to chromosome 1p35-p32. This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described.
UniProt P06239
Pathways TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling
Indications d'application Optimal dilution of the LCK antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the LCK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Lymphocyte-Specific Protein tyrosine Kinase (LCK) antibody (ABIN4951597) IHC testing of FFPE rat lymph node with LCK antibody. HIER: Boil the paraffin section...
Image no. 2 for anti-Lymphocyte-Specific Protein tyrosine Kinase (LCK) antibody (ABIN4951597) Western blot testing of human 1) HUT, 2) Jurkat, 3) Raji, 4) CEM and 5) K562 cell lys...
Image no. 3 for anti-Lymphocyte-Specific Protein tyrosine Kinase (LCK) antibody (ABIN4951597) IHC testing of FFPE mouse lymph node with LCK antibody. HIER: Boil the paraffin secti...
Avez-vous cherché autre chose?