LCK anticorps
-
- Antigène Voir toutes LCK Anticorps
- LCK (Lymphocyte-Specific Protein tyrosine Kinase (LCK))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LCK est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity
- Immunogène
- Amino acids ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ of human Lymphocyte-specific protein tyrosine kinase were used as the immunogen for the LCK antibody.
- Isotype
- IgG
- Top Product
- Discover our top product LCK Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the LCK antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the LCK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- LCK (Lymphocyte-Specific Protein tyrosine Kinase (LCK))
- Autre désignation
- LCK (LCK Produits)
- Synonymes
-
anticorps zgc:136695, anticorps LCK, anticorps Hck-3, anticorps Lsk, anticorps Lskt, anticorps p56
, anticorps p56Lck, anticorps LSK, anticorps YT16, anticorps p56lck, anticorps pp58lck, anticorps P56LCK, anticorps tkl, anticorps Lck1, anticorps Lcktkr, anticorps LCK proto-oncogene, Src family tyrosine kinase, anticorps lymphocyte protein tyrosine kinase, anticorps lck, anticorps LCK, anticorps Lck - Sujet
- Lck (or lymphocyte-specific protein tyrosine kinase) is a protein found inside specialized cells of the immune system called lymphocytes. The human LCK gene is mapped to chromosome 1p35-p32. This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described.
- UniProt
- P06239
- Pathways
- TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling
-