Leptin anticorps (LEP)

Details for Product anti-LEP Antibody No. ABIN4951605
Antigène
  • ob
  • obese
  • LEPD
  • OB
  • OBS
  • leptin
  • Lep
  • LEP
  • lep
Reactivité
Souris
332
164
147
26
11
8
7
7
6
5
4
3
3
2
2
2
1
1
1
1
Hôte
Lapin
363
124
20
10
4
2
1
Clonalité
Polyclonal
Conjugué
Cet anticorp Leptin est non-conjugé
59
22
13
11
10
6
5
5
5
5
5
5
3
3
3
3
3
3
Application
ELISA, Western Blotting (WB)
358
310
122
49
45
41
39
38
30
28
28
17
17
13
4
4
4
3
3
2
2
1
1
1
1
1
Options
Immunogène Amino acids KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH of mouse Leptin were used as the immunogen for the Leptin antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others Leptin products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation Leptin / LEP (LEP Antibody Extrait)
Sujet Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse, and rat cells. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. Although regulation of fat stores is deemed to be the primary function of leptin, it also plays a role in other physiological processes, as evidenced by its multiple sites of synthesis other than fat cells, and the multiple cell types beside hypothalamic cells that have leptin receptors. Many of these additional functions are yet to be defined.
UniProt P41160
Pathways Signalistation JAK/STAT, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process
Indications d'application Optimal dilution of the Leptin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the Leptin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Leptin (LEP) antibody (ABIN4951605) Western blot testing of mouse NIH3T3 cell lysate with Leptin antibody. Expected/obser...
Avez-vous cherché autre chose?