Leptin anticorps

N° du produit ABIN4951605

Détail du produit anti-Leptin anticorps

Antigène: Leptin (LEP)

Reactivité: Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Leptin est non-conjugé

Application: Western Blotting (WB), ELISA

Purification: Antigen affinity

Immunogène: Amino acids KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH of mouse Leptin were used as the immunogen for the Leptin antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Leptin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Leptin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Leptin

Antigène: Leptin (LEP)

Autre désignation: Leptin / LEP (LEP Produits)

Synonymes: anticorps ob, anticorps obese, anticorps LEPD, anticorps OB, anticorps OBS, anticorps leptin, anticorps Lep, anticorps LEP, anticorps lep

Sujet: Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse, and rat cells. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. Although regulation of fat stores is deemed to be the primary function of leptin, it also plays a role in other physiological processes, as evidenced by its multiple sites of synthesis other than fat cells, and the multiple cell types beside hypothalamic cells that have leptin receptors. Many of these additional functions are yet to be defined.

UniProt: P41160

Pathways: Signalistation JAK/STAT, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process