Lysyl Oxidase-Like 2 (LOXL2) anticorps

Détails pour le produit réf. ABIN4951635
Antigène
  • LOR2
  • WS9-14
  • CG4402
  • Dmel\\CG4402
  • Dmloxl-2
  • dmlox-2
  • 1110004B06Rik
  • 4930526G11Rik
  • 9430067E15Rik
  • GB13360
  • lox2-like
  • LOXL2
  • lor2
  • loxl-2
  • ws9-14
  • im:7136137
  • si:dkeyp-32b1.1
  • wu:fk12g04
  • zgc:158414
  • lysyl oxidase like 2
  • lysyl oxidase-like 2
  • lysyl oxidase homolog 4
  • lysyl oxidase like 2 L homeolog
  • lysyl oxidase-like 2b
  • LOXL2
  • lox2
  • Loxl2
  • LOC408544
  • loxl2.L
  • loxl2
  • loxl2b
Reactivité
Humain, Souris, Rat (Rattus)
91
41
33
5
5
5
5
4
3
3
1
1
1
1
Hôte
Lapin
109
12
Clonalité
Polyclonal
Conjugué
Inconjugué
15
9
5
2
2
2
2
2
2
2
2
2
Application
Western Blotting (WB)
84
41
35
18
8
5
5
5
3
3
1
1
1
Options
Immunogène Amino acids HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ of human Lysyl oxidase homolog 2 were used as the immunogen for the LOXL2 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation LOXL2 (LOXL2 Antibody Extrait)
Sujet Lysyl oxidase homolog 2 is an enzyme that in humans is encoded by the LOXL2 gene. This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. LOXL2 can also crosslink collagen type IV and hence influence the sprouting of new blood vessels.
UniProt Q9Y4K0
Pathways Chromatin Binding
Indications d'application Optimal dilution of the LOXL2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the LOXL2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Lysyl Oxidase-Like 2 (LOXL2) antibody (ABIN4951635) Western blot testing of 1) mouse testis, 2) rat ovary, human 3) placenta, 4) HeLa, 5)...
Avez-vous cherché autre chose?