LOXL2 anticorps
-
- Antigène Voir toutes LOXL2 Anticorps
- LOXL2 (Lysyl Oxidase-Like 2 (LOXL2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LOXL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogène
- Amino acids HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ of human Lysyl oxidase homolog 2 were used as the immunogen for the LOXL2 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product LOXL2 Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the LOXL2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the LOXL2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- LOXL2 (Lysyl Oxidase-Like 2 (LOXL2))
- Autre désignation
- LOXL2 (LOXL2 Produits)
- Synonymes
- anticorps LOR2, anticorps WS9-14, anticorps CG4402, anticorps Dmel\\CG4402, anticorps Dmloxl-2, anticorps dmlox-2, anticorps 1110004B06Rik, anticorps 4930526G11Rik, anticorps 9430067E15Rik, anticorps GB13360, anticorps lox2-like, anticorps LOXL2, anticorps lor2, anticorps loxl-2, anticorps ws9-14, anticorps im:7136137, anticorps si:dkeyp-32b1.1, anticorps wu:fk12g04, anticorps zgc:158414, anticorps lysyl oxidase like 2, anticorps lysyl oxidase-like 2, anticorps lysyl oxidase homolog 4, anticorps lysyl oxidase like 2 L homeolog, anticorps lysyl oxidase-like 2b, anticorps LOXL2, anticorps lox2, anticorps Loxl2, anticorps LOC408544, anticorps loxl2.L, anticorps loxl2, anticorps loxl2b
- Sujet
- Lysyl oxidase homolog 2 is an enzyme that in humans is encoded by the LOXL2 gene. This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. LOXL2 can also crosslink collagen type IV and hence influence the sprouting of new blood vessels.
- UniProt
- Q9Y4K0
- Pathways
- Chromatin Binding
-