Monoamine Oxidase A anticorps

N° du produit ABIN4951664

Détail du produit anti-Monoamine Oxidase A anticorps

Antigène: Monoamine Oxidase A (MAOA)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Monoamine Oxidase A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER of human MAOA were used as the immunogen for the MAOA antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MAOA antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the MAOA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Monoamine Oxidase A

Antigène: Monoamine Oxidase A (MAOA)

Autre désignation: Monoamine Oxidase A / MAOA (MAOA Produits)

Synonymes: anticorps MAO-A, anticorps 1110061B18Rik, anticorps AA407771, anticorps Mao, anticorps MAOA, anticorps LOC100221249, anticorps Z-MAO, anticorps maob, anticorps moa, anticorps wu:fb68b05, anticorps wu:fo76d11, anticorps wu:fq38g06, anticorps zgc:85761, anticorps monoamine oxidase A, anticorps monoamine oxidase A L homeolog, anticorps amine oxidase [flavin-containing] A, anticorps monoamine oxidase, anticorps MAOA, anticorps Maoa, anticorps maoa.L, anticorps mll3668, anticorps maoa, anticorps LOC100221249, anticorps mao

Sujet: Monoamine oxidase A is an enzyme that in humans is encoded by the MAO-A gene. MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11.3. MAOA degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the outer mitochondrial membrane. Mutation in MAOA results in monoamine oxidase deficiency, or Brunner syndrome. In humans, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA. MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34 % in patients with major depressive disorder. Inhibition of MAOA prevented apoptosis, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice.

UniProt: P21397