Monoamine Oxidase A anticorps (MAOA)

Details for Product anti-MAOA Antibody No. ABIN4951664
Antigène
  • MAO-A
  • 1110061B18Rik
  • AA407771
  • Mao
  • MAOA
  • LOC100221249
  • Z-MAO
  • maob
  • moa
  • wu:fb68b05
  • wu:fo76d11
  • wu:fq38g06
  • zgc:85761
  • monoamine oxidase A
  • monoamine oxidase A L homeolog
  • amine oxidase [flavin-containing] A
  • monoamine oxidase
  • MAOA
  • Maoa
  • maoa.L
  • mll3668
  • maoa
  • LOC100221249
  • mao
Reactivité
Humain, Souris, Rat (Rattus)
96
60
52
13
6
5
5
3
3
2
2
1
1
1
Hôte
Lapin
88
13
7
Clonalité
Polyclonal
Conjugué
Cet anticorp Monoamine Oxidase A est non-conjugé
7
2
2
2
2
2
2
2
2
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
95
43
33
13
5
5
4
2
2
1
Options
Immunogène Amino acids REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER of human MAOA were used as the immunogen for the MAOA antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others Monoamine Oxidase A products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation Monoamine Oxidase A / MAOA (MAOA Antibody Extrait)
Sujet Monoamine oxidase A is an enzyme that in humans is encoded by the MAO-A gene. MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11.3. MAOA degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the outer mitochondrial membrane. Mutation in MAOA results in monoamine oxidase deficiency, or Brunner syndrome. In humans, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA. MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34 % in patients with major depressive disorder. Inhibition of MAOA prevented apoptosis, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice.
UniProt P21397
Indications d'application Optimal dilution of the MAOA antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the MAOA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Monoamine Oxidase A (MAOA) antibody (ABIN4951664) Western blot testing of 1) rat kidney, 2) mouse kidney, 3) human COLO320, 4) human He...
Image no. 2 for anti-Monoamine Oxidase A (MAOA) antibody (ABIN4951664) IHC testing of FFPE mouse heart with MAOA antibody. HIER: Boil the paraffin sections ...
Image no. 3 for anti-Monoamine Oxidase A (MAOA) antibody (ABIN4951664) IHC testing of FFPE rat heart with MAOA antibody. HIER: Boil the paraffin sections in...
Avez-vous cherché autre chose?