Monoamine Oxidase B anticorps

N° du produit ABIN4951665

Détail du produit anti-Monoamine Oxidase B anticorps

Antigène: Monoamine Oxidase B (MAOB)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Monoamine Oxidase B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER of human MAOB were used as the immunogen for the MAOB antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MAOB antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the MAOB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Monoamine Oxidase B

Antigène: Monoamine Oxidase B (MAOB)

Autre désignation: Monoamine Oxidase B / MAOB (MAOB Produits)

Synonymes: anticorps MAOB, anticorps Z-MAO, anticorps maob, anticorps moa, anticorps wu:fb68b05, anticorps wu:fo76d11, anticorps wu:fq38g06, anticorps zgc:85761, anticorps MAOA, anticorps 6330414K01Rik, anticorps MAO-B, anticorps monoamine oxidase B, anticorps amine oxidase [flavin-containing] B, anticorps monoamine oxidase, anticorps monoamine oxidase B L homeolog, anticorps MAOB, anticorps Gbro_4276, anticorps LOC100223232, anticorps mao, anticorps Maob, anticorps maob.L

Sujet: Monoamine oxidase B, also called MAO, BRAIN, is a protein that in humans is encoded by the MAOB gene. MAOB is a member of the flavin monoamine oxidase family. And it is mapped on Xp11.3. MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. Like MAOA, it also degrades dopamine. MAO-B is involved in the breakdown of dopamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement. MAO-B inhibition is, therefore, associated with enhanced activity of dopamine, as well as with decreased production of hydrogen peroxide, a source of reactive oxygen species.

UniProt: P27338