Monoamine Oxidase B anticorps (MAOB)

Details for Product anti-MAOB Antibody No. ABIN4951665
Antigène
  • MAOB
  • Z-MAO
  • maob
  • moa
  • wu:fb68b05
  • wu:fo76d11
  • wu:fq38g06
  • zgc:85761
  • MAOA
  • 6330414K01Rik
  • MAO-B
  • monoamine oxidase B
  • amine oxidase [flavin-containing] B
  • monoamine oxidase
  • monoamine oxidase B L homeolog
  • MAOB
  • Gbro_4276
  • LOC100223232
  • mao
  • Maob
  • maob.L
Reactivité
Humain, Souris, Rat (Rattus)
101
50
43
5
4
3
3
3
3
2
2
1
Hôte
Lapin
96
7
5
1
Clonalité
Polyclonal
Conjugué
Cet anticorp Monoamine Oxidase B est non-conjugé
8
5
5
4
4
4
4
4
4
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
79
38
33
22
13
9
3
3
2
2
1
1
Options
Immunogène Amino acids REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER of human MAOB were used as the immunogen for the MAOB antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others Monoamine Oxidase B products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation Monoamine Oxidase B / MAOB (MAOB Antibody Extrait)
Sujet Monoamine oxidase B, also called MAO, BRAIN, is a protein that in humans is encoded by the MAOB gene. MAOB is a member of the flavin monoamine oxidase family. And it is mapped on Xp11.3. MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. Like MAOA, it also degrades dopamine. MAO-B is involved in the breakdown of dopamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement. MAO-B inhibition is, therefore, associated with enhanced activity of dopamine, as well as with decreased production of hydrogen peroxide, a source of reactive oxygen species.
UniProt P27338
Indications d'application Optimal dilution of the MAOB antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the MAOB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Monoamine Oxidase B (MAOB) antibody (ABIN4951665) Western blot testing of 1) rat heart, 2) rat kidney, 3) rat intestine, 4) mouse kidne...
Image no. 2 for anti-Monoamine Oxidase B (MAOB) antibody (ABIN4951665) IHC testing of FFPE mouse intestine with MAOB antibody. HIER: Boil the paraffin secti...
Image no. 3 for anti-Monoamine Oxidase B (MAOB) antibody (ABIN4951665) IHC testing of FFPE rat intestine with MAOB antibody. HIER: Boil the paraffin section...
Avez-vous cherché autre chose?