MCM8 anticorps (Minichromosome Maintenance Deficient 8)

Details for Product anti-MCM8 Antibody No. ABIN4951692
Antigène
  • C20orf154
  • dJ967N21.5
  • 5730432L01Rik
  • minichromosome maintenance 8 homologous recombination repair factor
  • minichromosome maintenance 8 homologous recombination repair factor L homeolog
  • MCM8
  • Mcm8
  • mcm8.L
Reactivité
Humain
68
26
25
9
7
5
5
4
3
3
3
3
1
Hôte
Lapin
65
3
Clonalité
Polyclonal
Conjugué
Cet anticorp MCM8 est non-conjugé
4
3
3
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
59
36
6
2
1
Options
Immunogène Amino acids IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM of human MCM8 were used as the immunogen for the MCM8 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others MCM8 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation MCM8 (MCM8 Antibody Extrait)
Sujet DNA replication licensing factor MCM8 is a protein that in humans is encoded by the MCM8 gene. The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. And this protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.
UniProt Q9UJA3
Pathways Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
Indications d'application Optimal dilution of the MCM8 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the MCM8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Minichromosome Maintenance Deficient 8 (MCM8) antibody (ABIN4951692) Western blot testing of human 1) A549, 2) SW620, 3) HeLa, 4) PANC, and 5) HepG2 lysat...
Avez-vous cherché autre chose?