Relaxin 1 (RLN1) (AA 1-185) anticorps Primary Antibody
RLN1
Reactivité: Humain
WB
Hôte: Souris
Polyclonal
camera_alt 1
N° du produit ABIN519787
$440.00
Plus shipping costs $45.00
50 μL
local_shipping
Destination:
Etats-Unis
Envoi sous 11 à 12 jours ouvrables
-
- Antigène
- Épitope
- AA 1-185
- Reactivité
- Humain
- Hôte
- Souris
- Clonalité
- Polyclonal
- Conjugué
- Inconjugué
- Application
- Western Blotting (WB)
- Fonction
- Mouse polyclonal antibody raised against a full-length human RLN1 protein.
- Marque
- MaxPab®
- Réactivité croisée
- Humain
- Immunogène
immunogen: RLN1 (NP_008842.1, 1 a.a. ~ 185 a.a) full-length human protein.
Immunogen Sequence: MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Commentaires
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- No additive
- Agent conservateur
- Without preservative
- Conseil sur la manipulation
- Aliquot to avoid repeated freezing and thawing.
- Stock
- -20 °C
- Stockage commentaire
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Antigène
- Autre désignation
- RLN1 (RLN1 Antibody Extrait)
- Synonymes
- H1, H1RLX, RLXH1, bA12D24.3.1, bA12D24.3.2, Rln, rlx, RELAX, RLX1, RNL1, RLN1, RLX, relaxin 1, RLN1, Rln1
- Sujet
- Full Gene Name: relaxin 1
Synonyms: H1,RLXH1,bA12D24.3.1,bA12D24.3.2 - ID gène
- 6013
- NCBI Accession
- NP_008842, NM_006911
Vous êtes ici: