ACSL5 anticorps (Middle Region)
-
- Antigène Voir toutes ACSL5 Anticorps
- ACSL5 (Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5))
-
Épitope
- AA 337-378, Middle Region
-
Reactivité
- Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACSL5 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Long-chain-fatty-acid--CoA ligase 5(ACSL5) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- ADDMKTLKPT LFPAVPRLLN RIYDKVQNEA KTPLKKFLLK LA
- Réactivité croisée (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Attributs du produit
-
Rabbit IgG polyclonal antibody for Long-chain-fatty-acid--CoA ligase 5(ACSL5) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: acyl-CoA synthetase long-chain family member 5
Protein Name: Long-chain-fatty-acid--CoA ligase 5 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA), different from the related mouse and rat sequences by six amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ACSL5 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- ACSL5 (Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5))
- Autre désignation
- ACSL5 (ACSL5 Produits)
- Synonymes
- anticorps ACSL5, anticorps acs2, anticorps acs5, anticorps facl5, anticorps ACS2, anticorps ACS5, anticorps FACL5, anticorps 1700030F05Rik, anticorps Facl5, anticorps Acs5, anticorps zgc:92083, anticorps acyl-CoA synthetase long chain family member 5, anticorps acyl-CoA synthetase long-chain family member 5, anticorps ACSL5, anticorps acsl5, anticorps Acsl5
- Sujet
-
Long-chain-fatty-acid-CoA ligase 5 is an enzyme that in humans is encoded by the ACSL5 gene. The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.
Synonyms: ACS2 | ACS5 | Acyl CoA synthetase 5 | FACL5 | LACS 5 | Q9ULC5 - ID gène
- 51703
-