Superoxide dismutase copper chaperone anticorps (C-Term)

N° du produit ABIN5518744

Détail du produit anti-Superoxide dismutase copper chaperone anticorps

Antigène: Superoxide dismutase copper chaperone (CCS) (Copper Chaperone For Superoxide Dismutase (CCS))

Épitope: AA 174-209, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Superoxide dismutase copper chaperone est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Copper chaperone for superoxide dismutase(CCS) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: DADGRAIFRM EDEQLKVWDV IGRSLIIDEG EDDLGR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Copper chaperone for superoxide dismutase(CCS) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: copper chaperone for superoxide dismutase
Protein Name: Copper chaperone for superoxide dismutase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human CCS (174-209aa DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Superoxide dismutase copper chaperone

Antigène: Superoxide dismutase copper chaperone (CCS) (Copper Chaperone For Superoxide Dismutase (CCS))

Autre désignation: CCS (CCS Produits)

Synonymes: anticorps ccs, anticorps MGC82563, anticorps CCS, anticorps DDBDRAFT_0189222, anticorps DDBDRAFT_0238038, anticorps DDB_0189222, anticorps DDB_0238038, anticorps ATCCS, anticorps COPPER/ZINC SUPEROXIDE DISMUTASE COPPER CHAPERONE, anticorps F5O11.26, anticorps F5O11_26, anticorps copper chaperone for SOD1, anticorps Ccsd, anticorps copper chaperone for superoxide dismutase L homeolog, anticorps copper chaperone for superoxide dismutase, anticorps copper chaperone for SOD1, anticorps ccs.L, anticorps ccs, anticorps CCS, anticorps LOC552629, anticorps Ccs

Sujet: Copper chaperone for superoxide dismutase is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans.

Synonyms: CCS | SOD 4 | SOD4 | O14618

ID gène: 9973

UniProt: O14618

Pathways: Transition Metal Ion Homeostasis