GAD65 anticorps (N-Term)

N° du produit ABIN5518755

Détail du produit anti-GAD65 anticorps

Antigène: GAD65 (GAD2) (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kDa) (GAD2))

Épitope: AA 131-164, N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GAD65 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Glutamate decarboxylase 2(GAD2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KVIDFHYPNE LLQEYNWELA DQPQNLEEIL MHCQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Glutamate decarboxylase 2(GAD2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: glutamate decarboxylase 2 (pancreatic islets and brain, 65 kDa)
Protein Name: Glutamate decarboxylase 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-GAD65 (ABIN5518755)

Tian, Ma, Shi, Lou, Liu, Li: "Acrylamide neurotoxicity on the cerebrum of weaning rats." dans: Neural regeneration research, Vol. 10, Issue 6, pp. 938-43, (2015) (PubMed).

Détails sur GAD65

Antigène: GAD65 (GAD2) (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kDa) (GAD2))

Autre désignation: GAD2 (GAD2 Produits)

Synonymes: anticorps GAD65, anticorps gad65, anticorps F12P19.12, anticorps F12P19_12, anticorps GLUTAMATE DECARBOXYLASE 2, anticorps glutamate decarboxylase 2, anticorps zgc:112198, anticorps 6330404F12Rik, anticorps GAD(65), anticorps Gad-2, anticorps glutamate decarboxylase 2, anticorps glutamate decarboxylase 1, anticorps glutamic acid decarboxylase 2, anticorps GAD2, anticorps PTRG_06148, anticorps LOC9324534, anticorps Gad2, anticorps GAD1, anticorps gad2

Sujet: Glutamate decarboxylase 2, also known as GAD65, is an enzyme that in humans is encoded by the GAD2 gene. This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.

Synonyms: 4.1.1.15 | 65 kDa glutamic acid decarboxylase | DCE 2 | DCE2 | GAD 2 | GAD 65 | GAD2 | GAD-2 | GAD65 | GAD-65 | Glutamate decarboxylase 2 | Glutamate Decarboxylase 65 | Q05329

ID gène: 2572

UniProt: Q05329