DVL1 anticorps (Middle Region)

N° du produit ABIN5518825

Détail du produit anti-DVL1 anticorps

Antigène: DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))

Épitope: AA 401-438, Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DVL1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-1(DVL1) detection. Tested with WB, IHC-P in Human,Rat.

Séquence: APQLEEAPLT VKSDMSAVVR VMQLPDSGLE IRDRMWLK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-1(DVL1) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: dishevelled segment polarity protein 1
Protein Name: Segment polarity protein dishevelled homolog DVL-1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human DVL1 (401-438aa APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur DVL1

Antigène: DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))

Autre désignation: DVL1 (DVL1 Produits)

Synonymes: anticorps DVL, anticorps DVL1L1, anticorps DVL1P1, anticorps Dvl, anticorps mKIAA4029, anticorps dvl-1, anticorps DSH, anticorps DVL-1, anticorps dvl1, anticorps dvl2l, anticorps Xdsh, anticorps dsh1, anticorps dishevelled segment polarity protein 1, anticorps dishevelled, dsh homolog 1 (Drosophila), anticorps microRNA 6808, anticorps dishevelled segment polarity protein 1b, anticorps dishevelled segment polarity protein 1 L homeolog, anticorps DVL1, anticorps Dvl1, anticorps MIR6808, anticorps dvl1b, anticorps dvl1.L

Sujet: Segment polarity protein dishevelled homolog DVL-1 is a protein that in humans is encoded by the DVL1 gene. DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.

Synonyms: Dishevelled 1 | Dishevelled | Dishevelled-1 | Dishevelled1 | DSH homolog 1 | Dvl 1 | Dvl | Dvl1 | DVL1L1 | DVL1P1 | DRS2 | O14640

ID gène: 1855

UniProt: O14640

Pathways: Signalisation WNT, Synaptic Membrane, Skeletal Muscle Fiber Development