PIK3CB anticorps (Middle Region)

N° du produit ABIN5518862

Détail du produit anti-PIK3CB anticorps

Antigène: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Épitope: AA 556-598, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIK3CB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform(PIK3CB) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: DLIWTLRQDC REIFPQSLPK LLLSIKWNKL EDVAQLQALL QIW

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform(PIK3CB) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
Protein Name: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556-598aa DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-PIK3CB (ABIN5518862)

Mu, Ma, Shi, Zhen: "The expression of S100B protein in serum of patients with brain metastases from small-cell lung cancer and its clinical significance." dans: Oncology letters, Vol. 14, Issue 6, pp. 7107-7110, (2017) (PubMed).

Wang, Sun, Li, Dong, Li, Zhao: "Resveratrol attenuates intermittent hypoxia-induced insulin resistance in rats: involvement of Sirtuin 1 and the phosphatidylinositol-4,5-bisphosphate 3-kinase/AKT pathway." dans: Molecular medicine reports, Vol. 11, Issue 1, pp. 151-8, (2014) (PubMed).

Détails sur PIK3CB

Antigène: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Autre désignation: PIK3CB (PIK3CB Produits)

Synonymes: anticorps P110BETA, anticorps PI3K, anticorps PI3KBETA, anticorps PIK3C1, anticorps fb92a07, anticorps wu:fb92a07, anticorps 1110001J02Rik, anticorps AI447572, anticorps p110beta, anticorps PI3Kbeta, anticorps phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta, anticorps phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta, anticorps PIK3CB, anticorps pik3cb, anticorps Pik3cb

Sujet: Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform is an enzyme that in humans is encoded by the PIK3CB gene. This gene encodes an isoform of the catalytic subunit of phosphoinositide 3-kinase (PI3K). These kinases are important in signaling pathways involving receptors on the outer membrane of eukaryotic cells and are named for their catalytic subunit. The encoded protein is the catalytic subunit for PI3Kbeta (PI3KB). PI3KB has been shown to be part of the activation pathway in neutrophils which have bound immune complexes at sites of injury or infection. Alternative splicing results in multiple transcript variants.

Synonyms: p110 BETA | p110Beta | PI3K | PI3K beta | PI3K-beta | PI3Kbeta | PI3KCB | PIK3C1 | Pik3cb | P42338

ID gène: 5291

UniProt: P42338