LYN anticorps (C-Term)

N° du produit ABIN5518932

Détail du produit anti-LYN anticorps

Antigène: LYN (V-Yes-1 Yamaguchi Sarcoma Viral Related Oncogene Homolog (LYN))

Épitope: AA 470-501, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYN est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Tyrosine-protein kinase Lyn(LYN) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: DELYDIMKMC WKEKAEERPT FDYLQSVLDD FY

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Tyrosine-protein kinase Lyn(LYN) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: LYN proto-oncogene, Src family tyrosine kinase
Protein Name: Tyrosine-protein kinase Lyn

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn (470-501aa DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur LYN

Antigène: LYN (V-Yes-1 Yamaguchi Sarcoma Viral Related Oncogene Homolog (LYN))

Autre désignation: LYN (LYN Produits)

Synonymes: anticorps JTK8, anticorps p53Lyn, anticorps p56Lyn, anticorps lyn, anticorps LYN, anticorps AA407514, anticorps Hck-2, anticorps jtk8, anticorps lyn-A, anticorps CH73-38P6.3, anticorps zgc:92124, anticorps LYN proto-oncogene, Src family tyrosine kinase, anticorps v-yes-1 Yamaguchi sarcoma viral related oncogene homolog, anticorps tyrosine-protein kinase Lyn, anticorps LYN proto-oncogene, Src family tyrosine kinase L homeolog, anticorps LYN, anticorps lyn, anticorps Lyn, anticorps LOC100593961, anticorps lyn.L

Sujet: Tyrosine-protein kinase Lyn is a protein that in humans is encoded in humans by the LYN gene. It is mapped to 8q12.1. Lyn is a member of the Src family of protein tyrosine kinases. In various hematopoietic cells, Lyn has emerged as a key enzyme involved in the regulation of cell activation.Lyn has been described to have an inhibitory role in myeloid lineage proliferation.

Synonyms: Tyrosine-protein kinase Lyn, Lck/Yes-related novel protein tyrosine kinase, V-yes-1 Yamaguchi sarcoma viral related oncogene homolog, p53Lyn, p56Lyn, LYN, JTK8

ID gène: 4067

UniProt: P07948

Pathways: Fc-epsilon Receptor Signaling Pathway, Hormone Transport, Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling, Integrin Complex, BCR Signaling