RANBP2 anticorps (C-Term)

N° du produit ABIN5518951

Détail du produit anti-RANBP2 anticorps

Antigène: RANBP2 (RAN Binding Protein 2 (RANBP2))

Épitope: AA 3018-3057, C-Term

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RANBP2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase RanBP2(RANBP2) detection. Tested with WB in Human,Mouse,Rat.

Séquence: EQLAVRFKTK EVADCFKKTF EECQQNLMKL QKGHVSLAAE

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase RanBP2(RANBP2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: RAN binding protein 2
Protein Name: E3 SUMO-protein ligase RanBP2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human RanBP2 (3018-3057aa EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE), different from the related mouse sequence by nine amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur RANBP2

Antigène: RANBP2 (RAN Binding Protein 2 (RANBP2))

Autre désignation: RANBP2 (RANBP2 Produits)

Synonymes: anticorps ANE1, anticorps IIAE3, anticorps NUP358, anticorps TRP1, anticorps TRP2, anticorps A430087B05Rik, anticorps AI256741, anticorps RGD1560047, anticorps RANBP2, anticorps ane1, anticorps nup358, anticorps trp1, anticorps trp2, anticorps RAN binding protein 2, anticorps E3 SUMO-protein ligase RanBP2, anticorps RANBP2, anticorps Ranbp2, anticorps LOC474539, anticorps ranbp2, anticorps LOC100511376

Sujet: RAN binding protein 2 (RANBP2) is protein which in humans is encoded by the RANBP2 gene. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. And the encoded protein directly interacts with the E2 enzyme UBC9 and strongly enhances SUMO1 transfer from UBC9 to the SUMO1 target SP100. These findings place sumoylation at the cytoplasmic filaments of the nuclear pore complex and suggest that, for some substrates, modification and nuclear import are linked events. This gene is partially duplicated in a gene cluster that lies in a hot spot for recombination on chromosome 2q.

Synonyms: E3 SUMO-protein ligase RanBP2, 358 kDa nucleoporin, Nuclear pore complex protein Nup358, Nucleoporin Nup358, Ran-binding protein 2, RanBP2, p270, RANBP2, NUP358

ID gène: 5903

UniProt: P49792

Pathways: Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus