UCP2 anticorps (Middle Region)

N° du produit ABIN5518965

Détail du produit anti-UCP2 anticorps

Antigène: UCP2 (Uncoupling Protein 2 (Mitochondrial, Proton Carrier) (UCP2))

Épitope: AA 134-170, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UCP2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Mitochondrial uncoupling protein 2(UCP2) detection. Tested with WB in Human,Mouse,Rat.

Séquence: AQPTDVVKVR FQAQARAGGG RRYQSTVNAY KTIAREE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Mitochondrial uncoupling protein 2(UCP2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: uncoupling protein 2
Protein Name: Mitochondrial uncoupling protein 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human UCP2 (134-170aa AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-UCP2 (ABIN5518965)

Liu, He, Li: "Exhaustive training increases uncoupling protein 2 expression and decreases Bcl-2/Bax ratio in rat skeletal muscle." dans: Oxidative medicine and cellular longevity, Vol. 2013, pp. 780719, (2013) (PubMed).

Détails sur UCP2

Antigène: UCP2 (Uncoupling Protein 2 (Mitochondrial, Proton Carrier) (UCP2))

Autre désignation: UCP2 (UCP2 Produits)

Synonymes: anticorps UCP2, anticorps DKFZp470P1633, anticorps ucp2, anticorps MGC53319, anticorps MGC75881, anticorps cb74, anticorps ATUCP2, anticorps K19M22.21, anticorps K19M22_21, anticorps uncoupling protein 2, anticorps BMIQ4, anticorps SLC25A8, anticorps UCPH, anticorps Slc25a8, anticorps mitochondrial uncoupling protein 2, anticorps uncoupling protein 2, anticorps uncoupling protein 2 (mitochondrial, proton carrier) L homeolog, anticorps uncoupling protein 2 (mitochondrial, proton carrier), anticorps uncoupling protein 1, anticorps PTRG_09289, anticorps UCP2, anticorps LOC100282746, anticorps ucp2.L, anticorps ucp2, anticorps ucp1, anticorps Ucp2

Sujet: Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'.

Synonyms: Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8, UCPH, UCP2, SLC25A8

ID gène: 7351

UniProt: P55851

Pathways: Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Proton Transport