IL-1 beta anticorps
-
- Antigène Voir toutes IL-1 beta (IL1B) Anticorps
- IL-1 beta (IL1B) (Interleukin 1, beta (IL1B))
-
Reactivité
- Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IL-1 beta est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for IL1 beta detection. Tested with WB in Mouse,Rat.
- Séquence
- DPKQYPKKKM EKRFVFNKIE VKSKVEFESA E
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for IL1 beta detection. Tested with WB in Mouse,Rat.
Gene Name: interleukin 1 beta
Protein Name: Interleukin-1 beta - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence of mouse IL1 beta (DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE).
- Isotype
- IgG
- Top Product
- Discover our top product IL1B Anticorps primaire
-
-
- Indications d'application
-
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
miR-181a Induces Macrophage Polarized to M2 Phenotype and Promotes M2 Macrophage-mediated Tumor Cell Metastasis by Targeting KLF6 and C/EBPα." dans: Molecular therapy. Nucleic acids, Vol. 5, Issue 9, pp. e368, (2016) (PubMed).
: "NLRP3 inflammasome sequential changes in Staphylococcus aureus-induced mouse model of acute rhinosinusitis." dans: International journal of molecular sciences, Vol. 15, Issue 9, pp. 15806-20, (2015) (PubMed).
: "Gastrodin inhibits neuroinflammation in rotenone-induced Parkinson's disease model rats." dans: Neural regeneration research, Vol. 7, Issue 5, pp. 325-31, (2015) (PubMed).
: "Neuroprotective effect of kaempferol glycosides against brain injury and neuroinflammation by inhibiting the activation of NF-?B and STAT3 in transient focal stroke." dans: PLoS ONE, Vol. 8, Issue 2, pp. e55839, (2013) (PubMed).
: "Effects of extract of Buddleja officinalis on partial inflammation of lacrimal gland in castrated rabbits with dry eye." dans: International journal of ophthalmology, Vol. 3, Issue 2, pp. 114-9, (2012) (PubMed).
: "
-
miR-181a Induces Macrophage Polarized to M2 Phenotype and Promotes M2 Macrophage-mediated Tumor Cell Metastasis by Targeting KLF6 and C/EBPα." dans: Molecular therapy. Nucleic acids, Vol. 5, Issue 9, pp. e368, (2016) (PubMed).
-
- Antigène
- IL-1 beta (IL1B) (Interleukin 1, beta (IL1B))
- Autre désignation
- Il1b (IL1B Produits)
- Synonymes
- anticorps IL-1, anticorps IL1-BETA, anticorps IL1F2, anticorps IL-1BETA, anticorps IL1beta, anticorps il1-b, anticorps zgc:111873, anticorps IL-1B, anticorps IL-1beta, anticorps Il-1b, anticorps IL1B, anticorps IL-1 beta, anticorps IL-1b, anticorps interleukin 1 beta, anticorps interleukin 1, beta, anticorps IL1B, anticorps il1b, anticorps Il1b
- Sujet
-
Interleukin-1β (IL-1β) is a potent stimulator of bone resorption whose gene is mapped to 2q14, and has been implicated in the pathogenesis of high bone turnover and osteoporosis. IL-1β, a prominent microglia-derived cytokine, caused oligodendrocyte death in coculture with astrocytes and microglia, but not in pure culture of oligodendrocytes alone. It also can cause nuclear export of a specific NCOR corepressor complex, resulting in derepression of a specific subset of nuclear factor-kappa-B (NFKB)-regulated genes. Furthermore, Microenvironmental IL-1β and, to a lesser extent, IL-1α are required for in vivo angiogenesis and invasiveness of different tumor cells. Additional, the cooperation of IL-1β and PDGFB induces contractile-to-synthetic phenotype modulation of human aortic smooth muscle cells in culture. Moreover, the association with disease may be explained by the biologic properties of IL-1β, which is an important proinflammatory cytokine and a powerful inhibitor of gastric acid secretion.
Synonyms: Interleukin-1 beta, IL-1 beta, Il1b - ID gène
- 16176
- UniProt
- P10749
- Pathways
- Signalisation NF-kappaB, Interferon-gamma Pathway, Signalisation TLR, Negative Regulation of Hormone Secretion, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Autophagy, Cancer Immune Checkpoints, Inflammasome
-