Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

IL-1 beta anticorps

IL1B Reactivité: Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN5519006
  • Antigène Voir toutes IL-1 beta (IL1B) Anticorps
    IL-1 beta (IL1B) (Interleukin 1, beta (IL1B))
    Reactivité
    • 131
    • 92
    • 45
    • 28
    • 24
    • 14
    • 8
    • 8
    • 8
    • 7
    • 5
    • 3
    • 3
    • 1
    • 1
    • 1
    Souris, Rat
    Hôte
    • 175
    • 71
    • 8
    • 6
    • 4
    • 3
    • 2
    • 2
    Lapin
    Clonalité
    • 183
    • 86
    • 1
    Polyclonal
    Conjugué
    • 141
    • 45
    • 24
    • 10
    • 7
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    Cet anticorp IL-1 beta est non-conjugé
    Application
    • 185
    • 109
    • 90
    • 53
    • 48
    • 39
    • 28
    • 19
    • 17
    • 15
    • 14
    • 14
    • 12
    • 10
    • 8
    • 8
    • 6
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Fonction
    Rabbit IgG polyclonal antibody for IL1 beta detection. Tested with WB in Mouse,Rat.
    Séquence
    DPKQYPKKKM EKRFVFNKIE VKSKVEFESA E
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for IL1 beta detection. Tested with WB in Mouse,Rat.
    Gene Name: interleukin 1 beta
    Protein Name: Interleukin-1 beta
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence of mouse IL1 beta (DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE).
    Isotype
    IgG
    Top Product
    Discover our top product IL1B Anticorps primaire
  • Indications d'application
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Stock
    4 °C,-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Bi, Zeng, Zhao, Wei, Yu, Wang, Yu, Cao, Shan, Wei: "miR-181a Induces Macrophage Polarized to M2 Phenotype and Promotes M2 Macrophage-mediated Tumor Cell Metastasis by Targeting KLF6 and C/EBPα." dans: Molecular therapy. Nucleic acids, Vol. 5, Issue 9, pp. e368, (2016) (PubMed).

    Wang, Gong, Chen, Xiong, Zhou, Huang, Kong: "NLRP3 inflammasome sequential changes in Staphylococcus aureus-induced mouse model of acute rhinosinusitis." dans: International journal of molecular sciences, Vol. 15, Issue 9, pp. 15806-20, (2015) (PubMed).

    Li, Chen, Zhang, Song, Mu: "Gastrodin inhibits neuroinflammation in rotenone-induced Parkinson's disease model rats." dans: Neural regeneration research, Vol. 7, Issue 5, pp. 325-31, (2015) (PubMed).

    Yu, Chen, Wang, Kuang, Liu, Zhang, Du: "Neuroprotective effect of kaempferol glycosides against brain injury and neuroinflammation by inhibiting the activation of NF-?B and STAT3 in transient focal stroke." dans: PLoS ONE, Vol. 8, Issue 2, pp. e55839, (2013) (PubMed).

    Yao, Peng, Peng, Tan, Wu, Wu, Chen, Li, Li, Zhu: "Effects of extract of Buddleja officinalis on partial inflammation of lacrimal gland in castrated rabbits with dry eye." dans: International journal of ophthalmology, Vol. 3, Issue 2, pp. 114-9, (2012) (PubMed).

  • Antigène
    IL-1 beta (IL1B) (Interleukin 1, beta (IL1B))
    Autre désignation
    Il1b (IL1B Produits)
    Synonymes
    anticorps IL-1, anticorps IL1-BETA, anticorps IL1F2, anticorps IL-1BETA, anticorps IL1beta, anticorps il1-b, anticorps zgc:111873, anticorps IL-1B, anticorps IL-1beta, anticorps Il-1b, anticorps IL1B, anticorps IL-1 beta, anticorps IL-1b, anticorps interleukin 1 beta, anticorps interleukin 1, beta, anticorps IL1B, anticorps il1b, anticorps Il1b
    Sujet
    Interleukin-1β (IL-1β) is a potent stimulator of bone resorption whose gene is mapped to 2q14, and has been implicated in the pathogenesis of high bone turnover and osteoporosis. IL-1β, a prominent microglia-derived cytokine, caused oligodendrocyte death in coculture with astrocytes and microglia, but not in pure culture of oligodendrocytes alone. It also can cause nuclear export of a specific NCOR corepressor complex, resulting in derepression of a specific subset of nuclear factor-kappa-B (NFKB)-regulated genes. Furthermore, Microenvironmental IL-1β and, to a lesser extent, IL-1α are required for in vivo angiogenesis and invasiveness of different tumor cells. Additional, the cooperation of IL-1β and PDGFB induces contractile-to-synthetic phenotype modulation of human aortic smooth muscle cells in culture. Moreover, the association with disease may be explained by the biologic properties of IL-1β, which is an important proinflammatory cytokine and a powerful inhibitor of gastric acid secretion.

    Synonyms: Interleukin-1 beta, IL-1 beta, Il1b
    ID gène
    16176
    UniProt
    P10749
    Pathways
    Signalisation NF-kappaB, Interferon-gamma Pathway, Signalisation TLR, Negative Regulation of Hormone Secretion, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Autophagy, Cancer Immune Checkpoints, Inflammasome
Vous êtes ici:
Support technique