C9ORF72 anticorps (Chromosome 9 Open Reading Frame 72)

Details for Product anti-C9ORF72 Antibody No. ABIN5573519
Antigène
  • CZH9orf72
  • ALSFTD
  • FTDALS
  • AI840585
  • c9orf72
  • chromosome Z C9orf72 homolog
  • chromosome 9 open reading frame 72
  • RIKEN cDNA 3110043O21 gene
  • similar to RIKEN cDNA 3110043O21
  • chromosome 9 open reading frame 72 L homeolog
  • CZH9orf72
  • C9orf72
  • 3110043O21Rik
  • RGD1359108
  • c9orf72.L
Reactivité
Humain
49
21
21
Hôte
Lapin
46
3
Clonalité
Polyclonal
Conjugué
Cet anticorp C9ORF72 est non-conjugé
5
5
4
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
30
25
13
5
5
3
3
2
1
1
Options
Fonction Rabbit polyclonal antibody raised against recombinant C9orf72.
Immunogène

immunogen: Recombinant protein corresponding to amino acids of human C9orf72.

Immunogen Sequence: YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEI

Isotype IgG
 Réactivité croisée Humain
Plasmids, Primers & others Plasmids, Primers & others C9ORF72 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation C9orf72 (C9ORF72 Antibody Extrait)
Sujet Full Gene Name: chromosome 9 open reading frame 72
Synonyms: MGC23980,RP11-27J8.2
ID gène 203228
UniProt Q96LT7
Indications d'application Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Chromosome 9 Open Reading Frame 72 (C9ORF72) antibody (ABIN5573519) Immunohistochemical staining of human colon with C9orf72 polyclonal antibody strong ...
Avez-vous cherché autre chose?