Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

DSCR4 anticorps (Down Syndrome Critical Region Gene 4) Primary Antibody

DSCR4 Reactivité: Humain IHC (p), WB Hôte: Lapin Polyclonal
N° du produit ABIN5576847
$577.33
Plus shipping costs $45.00
100 μL
local_shipping Destination: Etats-Unis
Envoi sous 11 à 12 jours ouvrables
  • Antigène
    Reactivité
    Humain
    Hôte
    Lapin
    Clonalité
    Polyclonal
    Conjugué
    Cet anticorp DSCR4 est non-conjugé
    Application
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
    Fonction
    Rabbit polyclonal antibody raised against recombinant DSCR4.
     Réactivité croisée
    Humain
    Immunogène

    immunogen: Recombinant protein corresponding to amino acids of human DSCR4.

    Immunogen Sequence: MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGR

    Isotype
    IgG
  • Indications d'application
    Immunohistochemistry (1:50-1:200)
    Western Blot (1:250-1:500)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Stock
    4 °C,-20 °C
    Stockage commentaire
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Antigène
    Autre désignation
    DSCR4 (DSCR4 Antibody Extrait)
    Sujet
    Full Gene Name: Down syndrome critical region gene 4
    Synonyms: DCRB,DSCRB
    ID gène
    10281
    UniProt
    P56555
Vous êtes ici: