INPP4A anticorps (Inositol Polyphosphate-4-Phosphatase, Type I, 107kDa) Primary Antibody
INPP4A
Reactivité: Humain
IHC (p)
Hôte: Lapin
Polyclonal
camera_alt 1
N° du produit ABIN5580977
$577.33
Plus shipping costs $45.00
100 μL
local_shipping
Destination:
Etats-Unis
Envoi sous 11 à 12 jours ouvrables
-
- Antigène
- Reactivité
- Humain
- Hôte
- Lapin
- Clonalité
- Polyclonal
- Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit polyclonal antibody raised against recombinant INPP4A
- Réactivité croisée
- Humain
- Immunogène
immunogen: Recombinant protein corresponding to amino acids of human INPP4A
Immunogen Sequence: SIAFFQDSLINQMTQVKLSVYDVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQRPPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDT
- Isotype
- IgG
-
-
- Indications d'application
- Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user. - Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- In PBS, pH 7.2, (40 % glycerol, 0.02 % sodium azide)
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
-
- Antigène
- Autre désignation
- INPP4A (INPP4A Antibody Extrait)
- Sujet
- Full Gene Name: inositol polyphosphate-4-phosphatase, type I, 107 kDa
Synonyms: INPP4 - ID gène
- 3631
Vous êtes ici: