Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1) anticorps

N° du produit ABIN5581606

Détail du produit

Antigène:

Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)

Fonction: Rabbit polyclonal antibody raised against recombinant KCNG1.

Réactivité croisée: Humain, Souris, Rat (Rattus)

Immunogène:

immunogen: Recombinant protein corresponding to amino acids of human KCNG1.

Immunogen Sequence: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFY

Isotype: IgG

Information d'application

Indications d'application: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 μg/mL)
The optimal working dilution should be determined by the end user.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.

Détail du antigène

Antigène:

Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1)

Autre désignation: KCNG1 (KCNG1 Antibody Extrait)

Sujet: Full Gene Name: potassium voltage-gated channel, subfamily G, member 1
Synonyms: K13,KCNG,KV6.1,MGC12878,kH2

ID gène: 3755

UniProt: Q9UIX4