Myeloid/lymphoid Or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila), Translocated To, 3 (MLLT3) anticorps Primary Antibody
MLLT3
Reactivité: Humain
IF, IHC (p), WB
Hôte: Lapin
Polyclonal
camera_alt 3
N° du produit ABIN5583592
$577.33
Plus shipping costs $45.00
100 μL
local_shipping
Destination:
Etats-Unis
Envoi sous 11 à 12 jours ouvrables
-
- Antigène
- Reactivité
- Humain
- Hôte
- Lapin
- Clonalité
- Polyclonal
- Conjugué
- Inconjugué
- Application
- Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
- Fonction
- Rabbit polyclonal antibody raised against recombinant human MLLT3.
- Réactivité croisée
- Humain
- Immunogène
immunogen: Recombinant protein corresponding to amino acids of human MLLT3.
Immunogen Sequence: SSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLR
- Isotype
- IgG
-
-
- Indications d'application
- Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 μg/mL)
The optimal working dilution should be determined by the end user. - Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
-
- Antigène
- Autre désignation
- MLLT3 (MLLT3 Antibody Extrait)
- Synonymes
- fc39c11, wu:fc39c11, zgc:110210, AF9, YEATS3, 2210011H10Rik, 2610012I03Rik, 3830408D16Rik, Af9, D4Ertd321e, Af-9, MLLT3, super elongation complex subunit, myeloid/lymphoid or mixed-lineage leukemia; translocated to, 3, mllt3, MLLT3, Mllt3
- Sujet
- Full Gene Name: myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 3
Synonyms: AF9,FLJ2035,YEATS3 - ID gène
- 4300
- UniProt
- B7Z755
Vous êtes ici: