WDYHV1 anticorps (WDYHV Motif Containing 1)

Details for Product anti-WDYHV1 Antibody No. ABIN5590918
Antigène
Reactivité
Humain
11
5
2
2
2
1
1
1
1
Hôte
Lapin
11
Clonalité
Polyclonal
Conjugué
Cet anticorp WDYHV1 est non-conjugé
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
8
6
3
3
1
Options
Fonction Rabbit polyclonal antibody raised against recombinant WDYHV1.
Immunogène

immunogen: Recombinant protein corresponding to amino acids of human WDYHV1.

Immunogen Sequence: YLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSK

Isotype IgG
 Réactivité croisée Humain
Antigène
Autre désignation WDYHV1 (WDYHV1 Antibody Extrait)
Sujet Full Gene Name: WDYHV motif containing 1
Synonyms: C8orf32,FLJ10204
ID gène 55093
UniProt Q96HA8
Indications d'application Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-WDYHV Motif Containing 1 (WDYHV1) antibody (ABIN5590918) Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T ly...
Image no. 2 for anti-WDYHV Motif Containing 1 (WDYHV1) antibody (ABIN5590918) Immunohistochemical staining of human kidney with WDYHV1 polyclonal antibody shows s...