RUNX1T1 anticorps (Runt-Related Transcription Factor 1, Translocated To, 1 (Cyclin D-Related)) (AA 416-525)

Details for Product anti-RUNX1T1 Antibody No. ABIN560189
Antigène
Épitope
AA 416-525
7
7
4
3
2
1
1
1
1
1
Reactivité
Humain
52
27
15
9
8
6
5
5
4
4
4
3
2
2
Hôte
Souris
46
6
Clonalité
Polyclonal
Conjugué
Cet anticorp RUNX1T1 est non-conjugé
2
1
1
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
32
26
11
5
5
2
1
1
1
1
Options
Fonction Mouse polyclonal antibody raised against a partial recombinant RUNX1T1.
Immunogène

immunogen: RUNX1T1 (NP_004340, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG

 Réactivité croisée Humain
Antigène
Autre désignation RUNX1T1 (RUNX1T1 Antibody Extrait)
Sujet Full Gene Name: runt-related transcription factor 1, translocated to, 1 (cyclin D-related)
Synonyms: AML1T1,CBFA2T1,CDR,ETO,MGC2796,MTG8,MTG8b,ZMYND2
ID gène 862
NCBI Accession NP_004340, NM_004349
Indications d'application Optimal working dilution should be determined by the investigator.
Commentaires

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Conseil sur la manipulation Aliquot to avoid repeated freezing and thawing.
Stock -20 °C
Stockage commentaire Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Runt-Related Transcription Factor 1, Translocated To, 1 (Cyclin D-Related) (RUNX1T1) (AA 416-525) antibody (ABIN560189) Western Blot detection against Immunogen (38.21 KDa) .
Produit citée dans: Chu, Liu, Nix, Wu, Ralston, Yates, Meyer: "Sperm chromatin proteomics identifies evolutionarily conserved fertility factors." dans: Nature, Vol. 443, Issue 7107, pp. 101-5, 2006 (PubMed).

Abdelhaleem: "RNA helicases: regulators of differentiation." dans: Clinical biochemistry, Vol. 38, Issue 6, pp. 499-503, 2005 (PubMed).

Hoet, Cohen, Kent, Rookey, Schoonbroodt, Hogan, Rem, Frans, Daukandt, Pieters, van Hegelsom, Neer, Nastri, Rondon, Leeds, Hufton, Huang, Kashin, Devlin, Kuang, Steukers, Viswanathan, Nixon, Sexton et al.: "Generation of high-affinity human antibodies by combining donor-derived and synthetic complementarity-determining-region diversity. ..." dans: Nature biotechnology, Vol. 23, Issue 3, pp. 344-8, 2005 (PubMed).

Zeeman, Stoop, Boter, Gillis, Castrillon, Oosterhuis, Looijenga: "VASA is a specific marker for both normal and malignant human germ cells." dans: Laboratory investigation; a journal of technical methods and pathology, Vol. 82, Issue 2, pp. 159-66, 2002 (PubMed).