Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

RUNX1T1 anticorps (Runt-Related Transcription Factor 1, Translocated To, 1 (Cyclin D-Related)) (AA 416-525) Primary Antibody

RUNX1T1 Reactivité: Humain ELISA, WB Hôte: Souris Polyclonal unconjugated
Pubmed (4)
N° du produit ABIN560189
$398.67
Plus shipping costs $45.00
50 μL
local_shipping Destination: Etats-Unis
Envoi sous 11 à 12 jours ouvrables
  • Antigène
    RUNX1T1
    Épitope
    AA 416-525
    • 6
    • 5
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivité
    Humain
    • 41
    • 21
    • 12
    • 8
    • 7
    • 6
    • 5
    • 5
    • 4
    • 4
    • 3
    • 3
    • 2
    • 1
    Hôte
    Souris
    • 38
    • 3
    Clonalité
    Polyclonal
    • 39
    • 2
    Conjugué
    Cet anticorp RUNX1T1 est non-conjugé
    • 31
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    ELISA, Western Blotting (WB)
    • 25
    • 17
    • 8
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Fonction
    Mouse polyclonal antibody raised against a partial recombinant RUNX1T1.
     Réactivité croisée
    Humain
    Immunogène

    immunogen: RUNX1T1 (NP_004340, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag.

    Immunogen Sequence: EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG

  • Indications d'application
    Optimal working dilution should be determined by the investigator.
    Commentaires

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    50 % glycerol
    Conseil sur la manipulation
    Aliquot to avoid repeated freezing and thawing.
    Stock
    -20 °C
    Stockage commentaire
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Chu, Liu, Nix, Wu, Ralston, Yates, Meyer: "Sperm chromatin proteomics identifies evolutionarily conserved fertility factors." dans: Nature, Vol. 443, Issue 7107, pp. 101-5, 2006 (PubMed).

    Abdelhaleem: "RNA helicases: regulators of differentiation." dans: Clinical biochemistry, Vol. 38, Issue 6, pp. 499-503, 2005 (PubMed).

    Hoet, Cohen, Kent, Rookey, Schoonbroodt, Hogan, Rem, Frans, Daukandt, Pieters, van Hegelsom, Neer, Nastri, Rondon, Leeds, Hufton, Huang, Kashin, Devlin, Kuang, Steukers, Viswanathan, Nixon, Sexton et al.: "Generation of high-affinity human antibodies by combining donor-derived and synthetic complementarity-determining-region diversity. ..." dans: Nature biotechnology, Vol. 23, Issue 3, pp. 344-8, 2005 (PubMed).

    Zeeman, Stoop, Boter, Gillis, Castrillon, Oosterhuis, Looijenga: "VASA is a specific marker for both normal and malignant human germ cells." dans: Laboratory investigation; a journal of technical methods and pathology, Vol. 82, Issue 2, pp. 159-66, 2002 (PubMed).

  • Antigène
    RUNX1T1
    Autre désignation
    RUNX1T1 (RUNX1T1 Antibody Extrait)
    Synonymes
    MTG8, si:ch211-232j17.1, wu:fi14b07, zgc:154044, AML1T1, CBFA2T1, CDR, ETO, ZMYND2, Cbfa2t1h, Cbfa2t1, runt-related transcription factor 1; translocated to, 1 (cyclin D-related), RUNX1 translocation partner 1 L homeolog, RUNX1 translocation partner 1, runx1t1, runx1t1.L, RUNX1T1, Runx1t1
    Sujet
    Full Gene Name: runt-related transcription factor 1, translocated to, 1 (cyclin D-related)
    Synonyms: AML1T1,CBFA2T1,CDR,ETO,MGC2796,MTG8,MTG8b,ZMYND2
    ID gène
    862
    NCBI Accession
    NP_004340, NM_004349
Vous êtes ici:
help Support technique