Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

Guanine Nucleotide Binding Protein Like Protein 1 (GNL1) (AA 111-209) anticorps Primary Antibody

GNL1 Reactivité: Humain ELISA, WB Hôte: Souris Polyclonal unconjugated
N° du produit ABIN561083
$398.67
Plus shipping costs $45.00
50 μL
local_shipping Destination: Etats-Unis
Envoi sous 11 à 12 jours ouvrables
  • Antigène
    Guanine Nucleotide Binding Protein Like Protein 1 (GNL1)
    Épitope
    AA 111-209
    • 8
    • 8
    • 8
    • 7
    • 4
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivité
    Humain
    • 54
    • 28
    • 28
    • 5
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 1
    Hôte
    Souris
    • 52
    • 2
    Clonalité
    Polyclonal
    • 54
    Conjugué
    Inconjugué
    • 23
    • 5
    • 4
    • 4
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    ELISA, Western Blotting (WB)
    • 38
    • 25
    • 13
    • 4
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    Fonction
    Mouse polyclonal antibody raised against a partial recombinant GNL1.
     Réactivité croisée
    Humain
    Immunogène

    immunogen: GNL1 (NP_005266, 111 a.a. ~ 209 a.a) partial recombinant protein with GST tag.

    Immunogen Sequence: ELLELDIREVYQPGSVLDFPRRPPWSYEMSKEQLMSQEERSFQDYLGKIHGAYSSEKLSYFEHNLETWRQLWRVLEMSDIVLLITDIRHPVVNFPPALY

  • Indications d'application
    Optimal working dilution should be determined by the investigator.
    Commentaires

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    50 % glycerol
    Conseil sur la manipulation
    Aliquot to avoid repeated freezing and thawing.
    Stock
    -20 °C
    Stockage commentaire
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Antigène
    Guanine Nucleotide Binding Protein Like Protein 1 (GNL1)
    Autre désignation
    GNL1 (GNL1 Antibody Extrait)
    Synonymes
    HSR1, Gna-rs1, Gnal1, G protein nucleolar 1 (putative), guanine nucleotide binding protein-like 1, G protein nucleolar 1, GNL1, Gnl1
    Sujet
    Full Gene Name: guanine nucleotide binding protein-like 1
    Synonyms: HSR1
    ID gène
    2794
    NCBI Accession
    NP_005266, NM_005275
Vous êtes ici:
help Support technique