PAN2 anticorps (PAN2 Poly(A) Specific Ribonuclease Subunit Homolog (S. Cerevisiae)) (AA 1099-1198)

Details for Product anti-PAN2 Antibody No. ABIN564262
Antigène
Épitope
AA 1099-1198
9
8
8
7
4
1
Reactivité
Humain
23
1
1
Hôte
Souris
22
1
Clonalité (Clone)
Monoclonal ()
Conjugué
Cet anticorp PAN2 est non-conjugé
3
3
3
2
2
2
Application
Immunofluorescence (IF), ELISA, Western Blotting (WB)
21
19
3
1
1
Options
Fonction Mouse monoclonal antibody raised against a partial recombinant USP52.
Immunogène

immunogen: USP52 (NP_055686, 1099 a.a. ~ 1198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: TVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVLAL

Clone 6A7
Isotype IgG1 kappa
 Réactivité croisée Humain
Antigène
Autre désignation PAN2 (PAN2 Antibody Extrait)
Sujet Full Gene Name: PAN2 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)
Synonyms: FLJ39360,KIAA0710,USP52,hPAN2
ID gène 9924
NCBI Accession NP_055686, NM_014871
Indications d'application Optimal working dilution should be determined by the investigator.
Commentaires

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Conseil sur la manipulation Aliquot to avoid repeated freezing and thawing.
Stock -20 °C
Stockage commentaire Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-PAN2 Poly(A) Specific Ribonuclease Subunit Homolog (S. Cerevisiae) (PAN2) (AA 1099-1198) antibody (ABIN564262) Immunofluorescence of monoclonal antibody to PAN2 on HeLa cell. [antibody concentrati...
Image no. 2 for anti-PAN2 Poly(A) Specific Ribonuclease Subunit Homolog (S. Cerevisiae) (PAN2) (AA 1099-1198) antibody (ABIN564262) Western Blot detection against Immunogen (36.74 KDa) .