Iba1 anticorps (AA 99-133)
-
- Antigène Voir toutes Iba1 (IBA1) Anticorps
- Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))
-
Épitope
- AA 99-133
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Iba1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogène
- Amino acids 99-133 (ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK) from the human protein were used as the immunogen for the IBA1 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product IBA1 Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the IBA1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the IBA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))
- Autre désignation
- IBA1 / AIF-1 (IBA1 Produits)
- Synonymes
- anticorps AIF-1, anticorps IBA1, anticorps IRT-1, anticorps IRT1, anticorps AI607846, anticorps D17H6S50E, anticorps G1, anticorps Iba1, anticorps Bart1, anticorps iba1, anticorps mrf-1, anticorps fa04b11, anticorps wu:fa04b11, anticorps AIF, anticorps AIF1, anticorps aif1, anticorps allograft inflammatory factor 1, anticorps AIF1, anticorps Aif1, anticorps aif1
- Sujet
- Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1 (IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.
- UniProt
- P55008
- Pathways
- Smooth Muscle Cell Migration
-