HTRA1 anticorps

N° du produit ABIN5647348

Détail du produit anti-HTRA1 anticorps

Antigène: HTRA1 (HtrA Serine Peptidase 1 (HTRA1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HTRA1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD were used as the immunogen for the HTRA1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HTRA1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the HTRA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HTRA1

Antigène: HTRA1 (HtrA Serine Peptidase 1 (HTRA1))

Autre désignation: HTRA1 (HTRA1 Produits)

Synonymes: anticorps htra1, anticorps zgc:92029, anticorps zgc:172061, anticorps l56, anticorps htra, anticorps Xhtra1, anticorps prss11, anticorps MGC145723, anticorps ARMD7, anticorps CARASIL, anticorps HtrA, anticorps L56, anticorps ORF480, anticorps PRSS11, anticorps AI429470, anticorps HTRA, anticorps Prss11, anticorps RSPP11, anticorps HTRA1, anticorps HtrA serine peptidase 1a, anticorps HtrA serine peptidase 1, anticorps HtrA serine peptidase 1b, anticorps Serine protease HTRA1, anticorps HtrA serine peptidase 1 S homeolog, anticorps htra1a, anticorps HTRA1, anticorps htra1b, anticorps htra1, anticorps Htra1, anticorps htra1.S

Sujet: Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7.

UniProt: Q92743

Pathways: Growth Factor Binding