Adenylosuccinate Lyase anticorps
-
- Antigène Voir toutes Adenylosuccinate Lyase (ADSL) Anticorps
- Adenylosuccinate Lyase (ADSL)
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Adenylosuccinate Lyase est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogène
- Amino acids YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN were used as the immunogen for the ASL antibody.
- Isotype
- IgG
- Top Product
- Discover our top product ADSL Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the ASL antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the ASL antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- Adenylosuccinate Lyase (ADSL)
- Autre désignation
- ASL / Adenylosuccinate Lyase (ADSL Produits)
- Synonymes
- anticorps fi60b04, anticorps zgc:56061, anticorps wu:fi60b04, anticorps MGC53383, anticorps MGC69239, anticorps adsL, anticorps F15C21.8, anticorps F15C21_8, anticorps AMPS, anticorps ASASE, anticorps ASL, anticorps Adl, anticorps Asl, anticorps purB, anticorps adenylosuccinate lyase, anticorps adenylosuccinate lyase L homeolog, anticorps adenylosuccinase; ASL, anticorps Adenylosuccinate lyase, anticorps L-Aspartase-like family protein, anticorps ADSL, anticorps adsl, anticorps adsl.L, anticorps ASL, anticorps purB, anticorps purB,adsL, anticorps Mrub_2293, anticorps MMAH_RS02975, anticorps Arnit_0089, anticorps Mesil_1058, anticorps Slip_0597, anticorps Trad_2452, anticorps Deba_0652, anticorps Toce_1174, anticorps Acear_2324, anticorps Igag_0272, anticorps Saut_2156, anticorps Fbal_1996, anticorps Ndas_2434, anticorps Ilyop_0196, anticorps Lbys_2961, anticorps MFER_RS02920, anticorps Palpr_2192, anticorps Calni_0061, anticorps Ftrac_3746, anticorps AT1G36280, anticorps Olsu_1764, anticorps Adsl
- Sujet
- ASL (argininosuccinate lyase, also known as argininosuccinase) is an enzyme that catalyzes the reversible breakdown of argininosuccinate (ASA) producing the amino acid arginine and dicarboxylic acid fumarate. Located in liver cytosol, ASL is the fourth enzyme of the urea cycle and involved in the biosynthesis of arginine in all species and the production of urea in ureotelic species. Mutations in ASL, resulting low activity of the enzyme, increase levels of urea in the body and result in various side effects. The ASL gene is located on chromosome 7 between the centromere (junction of the long and short arm) and the long (q) arm at position 11.2, from base pair 64,984,963 to base pair 65,002,090.
- UniProt
- P04424
- Pathways
- Ribonucleoside Biosynthetic Process
-