ABCA4 anticorps (AA 1890-1927)

N° du produit ABIN5647438

Détail du produit anti-ABCA4 anticorps

Antigène: ABCA4 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4 (ABCA4))

Épitope: AA 1890-1927

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCA4 est non-conjugé

Application: Western Blotting (WB)

Réactivité croisée (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogène: Amino acids 1890-1927 (FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR) from the human protein were used as the immunogen for the ABCA4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ABCA4 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ABCA4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ABCA4

Antigène: ABCA4 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4 (ABCA4))

Autre désignation: ABCA4 (ABCA4 Produits)

Synonymes: anticorps ABC10, anticorps ABCR, anticorps ARMD2, anticorps CORD3, anticorps FFM, anticorps RMP, anticorps RP19, anticorps STGD, anticorps STGD1, anticorps AW050280, anticorps Abc10, anticorps Abcr, anticorps D430003I15Rik, anticorps RmP, anticorps abcr, anticorps ffm, anticorps rmp, anticorps rp19, anticorps stgd, anticorps abc10, anticorps armd2, anticorps cord3, anticorps stgd1, anticorps zgc:91823, anticorps ATP binding cassette subfamily A member 4, anticorps ATP-binding cassette, sub-family A (ABC1), member 4, anticorps ATP binding cassette subfamily A member 4 L homeolog, anticorps ATP-binding cassette, sub-family A (ABC1), member 4a, anticorps ABCA4, anticorps Abca4, anticorps abca4, anticorps abca4.L, anticorps abca4a

Sujet: ABCA4 (ATP-Binding Cassette, Subfamily A, Member 4), also known as ABCR, is a protein which in humans is encoded by the ABCA4 gene. ABCA4 is a member of the ATP-binding cassette transporter gene sub-family A (ABC1) found exclusively in multicellular eukaryotes. Using a whole genome radiation hybrid panel, this gene is mapped to 1p21-p13. And this gene is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Additionally, it is showed by immunofluorescence microscopy and Western blot analysis that ABCR is present in foveal and peripheral cone, as well as rod, photoreceptors. The results suggested that the loss in central vision experienced by patients with Stargardt macular dystrophy arises directly from ABCR-mediated foveal cone degeneration.

UniProt: P78363