ANGPTL2 anticorps (AA 275-312)
-
- Antigène Voir toutes ANGPTL2 Anticorps
- ANGPTL2 (Angiopoietin-Like 2 (ANGPTL2))
-
Épitope
- AA 275-312
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ANGPTL2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogène
- Amino acids 275-312 (WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD) from the human protein were used as the immunogen for the ANGPTL2 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product ANGPTL2 Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the ANGPTL2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the ANGPTL2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- ANGPTL2 (Angiopoietin-Like 2 (ANGPTL2))
- Autre désignation
- ANGPTL2 (ANGPTL2 Produits)
- Synonymes
- anticorps ARP2, anticorps HARP, anticorps AI593246, anticorps AW260363, anticorps Arp2, anticorps ANGPTL2, anticorps angptl2, anticorps wu:fc41g02, anticorps arp2, anticorps fbnl, anticorps harp, anticorps angptl2a, anticorps angiopoietin like 2, anticorps angiopoietin-like 2, anticorps angiopoietin-like 2b, anticorps angiopoietin like 2 L homeolog, anticorps ANGPTL2, anticorps Angptl2, anticorps angptl2b, anticorps angptl2, anticorps angptl2.L
- Sujet
- Angiopoietin-related protein 2, also known as Angiopoietin-like protein 2, is a protein that in humans is encoded by the ANGPTL2 gene. Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action.
- UniProt
- Q9UKU9
-