E2F4 anticorps (AA 106-144)

N° du produit ABIN5647555

Détail du produit anti-E2F4 anticorps

Antigène: E2F4 (E2F Transcription Factor 4, P107/p130-Binding (E2F4))

Épitope: AA 106-144

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp E2F4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 106-144 (ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED) from the human protein were used as the immunogen for the E2F4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the E2F4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur E2F4

Antigène: E2F4 (E2F Transcription Factor 4, P107/p130-Binding (E2F4))

Autre désignation: E2F4 (E2F4 Produits)

Synonymes: anticorps E2F-4, anticorps 2010111M04Rik, anticorps AI427446, anticorps E2F4, anticorps e2f-4, anticorps fb72f07, anticorps wu:fb72f07, anticorps wu:fe05f06, anticorps zgc:63815, anticorps E2F transcription factor 4, anticorps E2F transcription factor 4 S homeolog, anticorps E2F4, anticorps E2f4, anticorps e2f4.S, anticorps e2f4

Sujet: E2F4 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two.

UniProt: Q16254

Pathways: Cycle Cellulaire, Mitotic G1-G1/S Phases, Regulation of Cell Size