BMP5 anticorps (C-Term) (DyLight 488)

N° du produit ABIN7354761

Détail du produit anti-BMP5 anticorps (DyLight 488)

Antigène: BMP5 (Bone Morphogenetic Protein 5 (BMP5))

Épitope: AA 332-365, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BMP5 est conjugé à/à la DyLight 488

Application: Flow Cytometry (FACS)

Séquence: HQDSSRMSSV GDYNTSEQKQ ACKKHELYVS FRDL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG Polyclonal Anti-Human BMP5 Antibody DyLight® 488 Conjugated, Flow Validated.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.

Information d'application

Indications d'application:

Application Details: Flow Cytometry, 1-3 μg/1x10⁶ cells

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C

Stockage commentaire: At 2-8°C for one year. Protect from light. Do not freeze.

Références pour anticorps anti-BMP5 (DyLight 488) (ABIN7354761)

Wang, Xue, Zhao, Liu, Ma, Ma: "Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." dans: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).

Détails sur BMP5

Antigène: BMP5 (Bone Morphogenetic Protein 5 (BMP5))

Autre désignation: BMP5 (BMP5 Produits)

Synonymes: anticorps bmp5l, anticorps hm:zehl0669, anticorps zehl0669, anticorps zgc:64230, anticorps BMP5, anticorps AU023399, anticorps se, anticorps bone morphogenetic protein 5, anticorps bmp5, anticorps BMP5, anticorps LOC100539495, anticorps Bmp5

Sujet:

Synonyms: Bone morphogenetic protein 5, BMP-5, BMP5

Tissue Specificity: Expressed in the lung and liver.

Background: Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.

UniProt: P22003

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process