NR4A3 anticorps

N° du produit ABIN5692903

Détail du produit anti-NR4A3 anticorps

Antigène: NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR4A3 est non-conjugé

Application: Western Blotting (WB)

Marque: Picoband™

Séquence: HDANTLYIFA PSPQSRDLWV KKLKEEIKNN NNIMIKYHPK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Tec detection. Tested with WB in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human Tec (HDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPK).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur NR4A3

Antigène: NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))

Autre désignation: TEC (NR4A3 Produits)

Synonymes: anticorps CHN, anticorps CSMF, anticorps MINOR, anticorps NOR1, anticorps TEC, anticorps AI573420, anticorps NOR-1, anticorps Nor1, anticorps NOR-2, anticorps NR4A3, anticorps Nr4a3, anticorps nuclear receptor subfamily 4 group A member 3, anticorps nuclear receptor subfamily 4, group A, member 3, anticorps NR4A3, anticorps Nr4a3, anticorps nr4a3

Sujet:

Synonyms: Tyrosine-protein kinase Tec, TEC, PSCTK4

Tissue Specificity: Expressed in a wide range of cells, including hematopoietic cell lines like myeloid, B-, and T-cell lineages.

Background: TEC (TEC Protein Tyrosine Kinase) is an enzyme that in humans is encoded by the TEC gene. The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. By fluorescence in situ hybridization, Sato et al. (1994) mapped the gene to 4p12, the same location reported for TXK. Mouse Tec is a non-receptor type protein-tyrosine kinase that is highly expressed in many hematopoietic cell lines. Hantschel et al. (2007) identified TEC kinase and BTK kinase as major binders of the tyrosine kinase inhibitor dasatinib, which is used for treatment of BCR/ABL-positive CML.

UniProt: P42680

Pathways: Fc-epsilon Receptor Signaling Pathway, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway