Regucalcin anticorps
-
- Antigène Voir toutes Regucalcin (RGN) Anticorps
- Regucalcin (RGN)
- Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Regucalcin est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Marque
- Picoband™
- Séquence
- YSVDAFDYDL QTGQISNRRS VYKLEKEEQI PD
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for Regucalcin detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Immunogène
- A synthetic peptide corresponding to a sequence of human Regucalcin (YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD).
- Top Product
- Discover our top product RGN Anticorps primaire
-
-
- Indications d'application
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- Regucalcin (RGN)
- Autre désignation
- RGN (RGN Produits)
- Synonymes
- anticorps CG1803, anticorps Dmel\\CG1803, anticorps Regucalcin, anticorps T1, anticorps GNL, anticorps zgc:92078, anticorps smp30, anticorps xsmp-30, anticorps xsmp30, anticorps DyakGE16489, anticorps dyak_GLEANR_17905, anticorps GE16489, anticorps regucalcin, anticorps SMP30, anticorps AI265316, anticorps RC, anticorps rgn-A, anticorps Rc, anticorps Reguc, anticorps SMP-30, anticorps CG1803 gene product from transcript CG1803-RA, anticorps regucalcin, anticorps GE16489 gene product from transcript GE16489-RB, anticorps regucalcin (senescence marker protein-30), anticorps regucalcin L homeolog, anticorps regucalcin, anticorps rgn, anticorps LOC465598, anticorps RGN, anticorps Dyak\regucalcin, anticorps Rgn, anticorps rgn.L
- Sujet
-
Synonyms: Regucalcin, RC, Gluconolactonase, GNL, Senescence marker protein 30, SMP-30, RGN, SMP30
Background: Regucalcin is a protein that in humans is encoded by the RGN gene. The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23.
- UniProt
- Q15493
-