HTRA1 anticorps

N° du produit ABIN5692999

Détail du produit anti-HTRA1 anticorps

Antigène: HTRA1 (HtrA Serine Peptidase 1 (HTRA1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HTRA1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Séquence: QLRAASRRSE RLHRPPVIVL QRGACGQGQE DPNSLRHKYN FIAD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for HTRA1 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur HTRA1

Antigène: HTRA1 (HtrA Serine Peptidase 1 (HTRA1))

Autre désignation: HTRA1 (HTRA1 Produits)

Synonymes: anticorps htra1, anticorps zgc:92029, anticorps zgc:172061, anticorps l56, anticorps htra, anticorps Xhtra1, anticorps prss11, anticorps MGC145723, anticorps ARMD7, anticorps CARASIL, anticorps HtrA, anticorps L56, anticorps ORF480, anticorps PRSS11, anticorps AI429470, anticorps HTRA, anticorps Prss11, anticorps RSPP11, anticorps HTRA1, anticorps HtrA serine peptidase 1a, anticorps HtrA serine peptidase 1, anticorps HtrA serine peptidase 1b, anticorps Serine protease HTRA1, anticorps HtrA serine peptidase 1 S homeolog, anticorps htra1a, anticorps HTRA1, anticorps htra1b, anticorps htra1, anticorps Htra1, anticorps htra1.S

Sujet:

Synonyms: Serine protease HTRA1, High-temperature requirement A serine peptidase 1, L56, Serine protease 11, HTRA1, HTRA, PRSS11

Tissue Specificity: Widely expressed, with strongest expression in placenta (at protein level). Secreted by synovial fibroblasts. Up- regulated in osteoarthritis and rheumatoid arthritis synovial fluids and cartilage as compared with non-arthritic (at protein level).

Background: Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7.

UniProt: Q92743

Pathways: Growth Factor Binding