14-3-3 zeta anticorps

N° du produit ABIN5693157

Détail du produit anti-14-3-3 zeta anticorps

Antigène: 14-3-3 zeta (YWHAZ)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp 14-3-3 zeta est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Marque: Picoband™

Séquence: LLEKFLIPNA SQAESKVFYL KMKGDYYRYL AEVAAGDDKK GIVDQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for 14-3-3 zeta/delta detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur 14-3-3 zeta

Antigène: 14-3-3 zeta (YWHAZ)

Autre désignation: YWHAZ (YWHAZ Produits)

Synonymes: anticorps 14-3-3-zeta, anticorps KCIP-1, anticorps YWHAD, anticorps 14-3-3zeta, anticorps Ywhaz, anticorps ACYPI003154, anticorps 14-3-3z, anticorps kcip-1, anticorps ywhaq, anticorps 1433z, anticorps ywhaz, anticorps ywhazb, anticorps 1110013I11Rik, anticorps AI596267, anticorps AL022924, anticorps AU020854, anticorps ywhaza, anticorps fb14h09, anticorps wu:fb05g08, anticorps wu:fb14h09, anticorps ywhai, anticorps zgc:55807, anticorps 14-3-3, anticorps 14-3-3 zeta, anticorps 14-3-3ZETA, anticorps 14-3-3leo, anticorps 2G1, anticorps 4-3-3 zeta, anticorps 5.11, anticorps 549, anticorps BEST:GH05075, anticorps CG17870, anticorps D14-3-3, anticorps D14-3-3zeta, anticorps Dmel\\CG17870, anticorps K, anticorps LEO, anticorps Leo, anticorps PAR-5, anticorps PAR5, anticorps Par-5, anticorps d14-3-3zeta, anticorps l(2)07103, anticorps l(2)46CFe, anticorps l(2)46Ee, anticorps leo, anticorps par-5, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta, anticorps 14-3-3 protein zeta, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog, anticorps 14-3-3 protein zeta/delta pseudogene, anticorps CG17870 gene product from transcript CG17870-RE, anticorps YWHAZ, anticorps 14-3-3zeta, anticorps ywhaz, anticorps 1433z, anticorps ywhaz.L, anticorps Ywhaz, anticorps ywhaz.S, anticorps LOC100855903

Sujet:

Synonyms: 14-3-3 protein zeta/delta, Protein kinase C inhibitor protein 1, KCIP-1, YWHAZ

Background: 14-3-3 protein zeta/delta (14-3-3ζ) is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99 % identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

UniProt: P63104

Pathways: Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location