Angiotensin I Converting Enzyme 1 anticorps

N° du produit ABIN5693158

Détail du produit anti-Angiotensin I Converting Enzyme 1 anticorps

Antigène: Angiotensin I Converting Enzyme 1 (ACE) (Angiotensin I Converting Enzyme (Peptidyl-Dipeptidase A) 1 (ACE))

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Angiotensin I Converting Enzyme 1 est non-conjugé

Application: Western Blotting (WB)

Marque: Picoband™

Séquence: AMMNYFKPLT EWLVTENRRH GETLGWPEYN WAPNTAR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Ace detection. Tested with WB in Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Angiotensin I Converting Enzyme 1 (ABIN5693158)

Yan, Shen: "Aliskiren has chondroprotective efficacy in a rat model of osteoarthritis through suppression of the local renin-angiotensin system." dans: Molecular medicine reports, Vol. 16, Issue 4, pp. 3965-3973, (2018) (PubMed).

Détails sur Angiotensin I Converting Enzyme 1

Antigène: Angiotensin I Converting Enzyme 1 (ACE) (Angiotensin I Converting Enzyme (Peptidyl-Dipeptidase A) 1 (ACE))

Autre désignation: Ace (ACE Produits)

Synonymes: anticorps ACE1, anticorps CD143, anticorps DCP, anticorps DCP1, anticorps ICH, anticorps MVCD3, anticorps AW208573, anticorps Dcp1, anticorps StsRR92, anticorps dcp, anticorps ace1, anticorps dcp1, anticorps xace, anticorps cd143, anticorps ACE, anticorps angiotensin I converting enzyme, anticorps angiotensin I converting enzyme (peptidyl-dipeptidase A) 1, anticorps angiotensin-converting enzyme, anticorps angiotensin I converting enzyme (peptidyl-dipeptidase A) 3, anticorps angiotensin-converting enzyme-like, anticorps ACE, anticorps Ace, anticorps ace, anticorps CpipJ_CPIJ009106, anticorps ACE3, anticorps LOC101824864

Sujet:

Synonyms: Angiotensin-converting enzyme, ACE, Dipeptidyl carboxypeptidase I, Kininase II, CD143, Angiotensin-converting enzyme, soluble form, Ace, Dcp1

Tissue Specificity: Testis-specific isoform is expressed in spermatocytes, adult testis.

Background: Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies.

UniProt: P09470

Pathways: ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour, Smooth Muscle Cell Migration